BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30408 (646 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC806.04c |||DUF89 family protein|Schizosaccharomyces pombe|ch... 28 1.0 SPBPB8B6.06c ||SPAPB8B6.06c, SPAPB8B6.06c|conserved fungal prote... 28 1.3 SPAC977.11 |||conserved fungal protein|Schizosaccharomyces pombe... 28 1.3 SPBC56F2.11 |met6||homoserine O-acetyltransferase|Schizosaccharo... 27 3.1 SPBC839.02 |||arrestin Aly1 related|Schizosaccharomyces pombe|ch... 25 9.3 SPCC1322.12c |bub1||serine/threonine protein kinase Bub1|Schizos... 25 9.3 SPAC24C9.02c |||cytochrome c1 heme lyase|Schizosaccharomyces pom... 25 9.3 >SPAC806.04c |||DUF89 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 440 Score = 28.3 bits (60), Expect = 1.0 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -1 Query: 532 LDDPTWPGVPWERSVCYYH 476 LD+ +W PW S CYY+ Sbjct: 99 LDNASWGNAPWLYSECYYY 117 >SPBPB8B6.06c ||SPAPB8B6.06c, SPAPB8B6.06c|conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 311 Score = 27.9 bits (59), Expect = 1.3 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = +2 Query: 74 PGAPFMGGAWERMVRAVKAALSATEQPRHPTPEIFHTLL 190 PGAPF G W + V V TE P P+ T L Sbjct: 29 PGAPFSGLLWVQFVGCVIMGFCQTESVFFPRPKHNATFL 67 >SPAC977.11 |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 311 Score = 27.9 bits (59), Expect = 1.3 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = +2 Query: 74 PGAPFMGGAWERMVRAVKAALSATEQPRHPTPEIFHTLL 190 PGAPF G W + V V TE P P+ T L Sbjct: 29 PGAPFSGLLWVQFVGCVIMGFCQTESVFFPRPKHNATFL 67 >SPBC56F2.11 |met6||homoserine O-acetyltransferase|Schizosaccharomyces pombe|chr 2|||Manual Length = 489 Score = 26.6 bits (56), Expect = 3.1 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = +3 Query: 294 RRESPCRANLTTPTS 338 RRE PCR+N ++PTS Sbjct: 285 RRERPCRSNGSSPTS 299 >SPBC839.02 |||arrestin Aly1 related|Schizosaccharomyces pombe|chr 2|||Manual Length = 530 Score = 25.0 bits (52), Expect = 9.3 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = -1 Query: 481 YHDVAYLQGGPAAVGLPPVLQVGQVLPEPATPEHICQ 371 YHD + G P++ G PV+++ +P +HI Q Sbjct: 9 YHDKVFPYG-PSSNGYNPVIRLTDRTTQPDPSQHIYQ 44 >SPCC1322.12c |bub1||serine/threonine protein kinase Bub1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1044 Score = 25.0 bits (52), Expect = 9.3 Identities = 17/58 (29%), Positives = 27/58 (46%), Gaps = 1/58 (1%) Frame = +2 Query: 131 ALSATEQPRHPTPEIFHTLLAEAEFT-VNSRPLTHVSVSADDPDPLTPNHFLLGGPAR 301 ALS + P+P I HT A A+ + ++PL S+ P++ LG P + Sbjct: 370 ALSPKPAQKPPSPTI-HTKAALADILDIFNQPLRSESLEKSSKSPISAQSSYLGTPLK 426 >SPAC24C9.02c |||cytochrome c1 heme lyase|Schizosaccharomyces pombe|chr 1|||Manual Length = 216 Score = 25.0 bits (52), Expect = 9.3 Identities = 10/34 (29%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -1 Query: 592 RANWVPGPPSSDAVGPRVNLLDDPTWPGV-PWER 494 R NW P P + P N +++ W + WE+ Sbjct: 83 RKNWNPHPEDMKTIVPIHNAVNERAWQDILQWEQ 116 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,548,724 Number of Sequences: 5004 Number of extensions: 52177 Number of successful extensions: 155 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 144 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 155 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 289756512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -