BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30407 (595 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q12VI3 Cluster: Cell surface protein precursor; n=1; Me... 35 1.3 UniRef50_Q8ILM9 Cluster: Putative uncharacterized protein; n=1; ... 33 5.0 >UniRef50_Q12VI3 Cluster: Cell surface protein precursor; n=1; Methanococcoides burtonii DSM 6242|Rep: Cell surface protein precursor - Methanococcoides burtonii (strain DSM 6242) Length = 1200 Score = 35.1 bits (77), Expect = 1.3 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +3 Query: 159 NKNFFTYLNDVNSIEVQLKTSNC*YEYQIKRPYNLITKKNVA 284 N F+ Y+ D N + SN Y Y I YN +TK NV+ Sbjct: 379 NYGFYIYIGDYNKLTKNTANSNSNYGYYIIGNYNTLTKNNVS 420 >UniRef50_Q8ILM9 Cluster: Putative uncharacterized protein; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein - Plasmodium falciparum (isolate 3D7) Length = 1630 Score = 33.1 bits (72), Expect = 5.0 Identities = 17/40 (42%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +3 Query: 105 ISTIQENHF-KFKIRRKYPNKNFFTYLNDVNSIEVQLKTS 221 + T + N + KFK + KY KNFF Y N++NS ++ L S Sbjct: 388 LPTYENNKYIKFKKKEKYKFKNFF-YYNNINSFDLTLLCS 426 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 479,342,635 Number of Sequences: 1657284 Number of extensions: 8414417 Number of successful extensions: 16014 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15620 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16012 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 41488046300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -