BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30406 (682 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12991| Best HMM Match : TP2 (HMM E-Value=1.4) 27 0.54 SB_39781| Best HMM Match : cNMP_binding (HMM E-Value=2.2e-19) 29 3.5 >SB_12991| Best HMM Match : TP2 (HMM E-Value=1.4) Length = 296 Score = 27.5 bits (58), Expect(2) = 0.54 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 356 KSRGIGLDYYYYYF 315 KSR + +DYYYYY+ Sbjct: 252 KSRLLAMDYYYYYY 265 Score = 23.0 bits (47), Expect(2) = 0.54 Identities = 6/7 (85%), Positives = 7/7 (100%) Frame = -3 Query: 332 YYYYYFC 312 YYYYY+C Sbjct: 289 YYYYYYC 295 >SB_39781| Best HMM Match : cNMP_binding (HMM E-Value=2.2e-19) Length = 1211 Score = 29.1 bits (62), Expect = 3.5 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -2 Query: 195 YYWIHWSYIHFAPHLKIELNISS*YCSKDNGQ 100 Y + +WS IH P L++ LNI + +D G+ Sbjct: 367 YVYGYWSDIHLVPELQLALNIFATGIQEDTGK 398 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,077,450 Number of Sequences: 59808 Number of extensions: 358372 Number of successful extensions: 600 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 548 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 595 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1757375282 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -