BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30406 (682 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 26 0.38 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 22 6.2 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 25.8 bits (54), Expect = 0.38 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 8/36 (22%) Frame = +1 Query: 181 MNPVIYNIHLNKDVQTK--------CPFNNSILKLD 264 M+ +Y + LN+DVQ K CP NN LK D Sbjct: 313 MSNALYELALNQDVQKKLREEINTFCPKNNKELKYD 348 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 21.8 bits (44), Expect = 6.2 Identities = 6/19 (31%), Positives = 11/19 (57%) Frame = +2 Query: 101 CPLSLEQYQEDIFNSILRW 157 CPL E + ++ + +L W Sbjct: 156 CPLIFESWTHNVLDMVLYW 174 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,890 Number of Sequences: 438 Number of extensions: 3540 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20708550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -