BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30402 (719 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43153| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_38188| Best HMM Match : rve (HMM E-Value=5.7e-31) 29 2.9 SB_799| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_19395| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_18508| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_50937| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_40488| Best HMM Match : HEAT (HMM E-Value=6.3e-08) 28 6.6 SB_10762| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_43491| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_30605| Best HMM Match : DUF601 (HMM E-Value=1.7) 28 8.8 SB_24810| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 SB_5064| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 SB_40530| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 SB_35866| Best HMM Match : TPR_MLP1_2 (HMM E-Value=0.34) 28 8.8 >SB_43153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 380 Score = 48.8 bits (111), Expect = 4e-06 Identities = 18/36 (50%), Positives = 26/36 (72%) Frame = +2 Query: 47 LNESLSDWIKKHVDETPLCILTPIFRDYEAYLKEIQ 154 LN+ +SDW++KHV P LTP+F DY ++KEI+ Sbjct: 111 LNQGVSDWVQKHVTSNPYIDLTPVFDDYRKHMKEIE 146 >SB_38188| Best HMM Match : rve (HMM E-Value=5.7e-31) Length = 836 Score = 29.5 bits (63), Expect = 2.9 Identities = 20/78 (25%), Positives = 35/78 (44%), Gaps = 2/78 (2%) Frame = +2 Query: 143 KEIQEEYHGPDGDCSEIETKKNVNSETKNPVEKSKNGIFSES--SRDLTVSGSSIFKLDP 316 +E ++Y + D SE+E +N+N + + K + + SES + L V+ F + Sbjct: 354 EECSDDYVFNENDFSELEASQNMNVSNIDGLCKDVSSLTSESIIASSLGVAVGPFFNIRK 413 Query: 317 SKPFSTTPLSSSCNMLGD 370 S SC+ GD Sbjct: 414 ESLECDAAPSPSCSSFGD 431 >SB_799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 29.5 bits (63), Expect = 2.9 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = -1 Query: 266 IQKKFHFLIFQQDFLFLN*HSFLSQFQSNHHLVHDTLPVFL 144 + K F ++++ + FL H FL + QS +H T+ L Sbjct: 298 VAKVFERIVYELFYAFLEKHDFLCKNQSGFRSIHSTMTALL 338 >SB_19395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 832 Score = 29.1 bits (62), Expect = 3.8 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = +3 Query: 630 KVEFTPIAEENSVFDKRCKVFVKKDGNFV 716 + + TP A++++VFD C+ KKDG+ V Sbjct: 243 QTDATPPADKSNVFDSSCEGKWKKDGSLV 271 >SB_18508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 709 Score = 28.7 bits (61), Expect = 5.0 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = +2 Query: 515 KSSPSSDGSPLKFGAPSLTSTNTNNTEPANQEDGRC--TSKSRI 640 +S+PS+ +P S ST +N + P+NQ C T+++RI Sbjct: 535 RSTPSNQSTPSNQTMHSNRSTPSNQSSPSNQRTTSCGLTTRNRI 578 >SB_50937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2480 Score = 28.3 bits (60), Expect = 6.6 Identities = 22/52 (42%), Positives = 31/52 (59%), Gaps = 2/52 (3%) Frame = +2 Query: 107 LTPIFRDYEAYLKEIQEEYHGPDGDCS-EI-ETKKNVNSETKNPVEKSKNGI 256 +TP+ RDY LKE ++ D D S E+ ETKK V ETK V+++K + Sbjct: 1268 VTPLERDYVTLLKEWVDK----DLDLSKEVNETKKEV-QETKKDVQETKKEV 1314 Score = 28.3 bits (60), Expect = 6.6 Identities = 27/73 (36%), Positives = 35/73 (47%), Gaps = 1/73 (1%) Frame = +2 Query: 65 DWIKKHVDETPLCILTPIFRDYEAYLKEIQEEYHGPDGDCSEI-ETKKNVNSETKNPVEK 241 D K VDET + +D + KE+QE D E+ ETKK + ETK V + Sbjct: 1315 DETKTKVDETKKEV-QETKKDVQETKKEVQETKTKVDETNKEVQETKKEI-QETKKDVHE 1372 Query: 242 SKNGIFSESSRDL 280 K G SE + DL Sbjct: 1373 VK-GKVSEMAVDL 1384 >SB_40488| Best HMM Match : HEAT (HMM E-Value=6.3e-08) Length = 1185 Score = 28.3 bits (60), Expect = 6.6 Identities = 19/62 (30%), Positives = 33/62 (53%) Frame = -3 Query: 258 KIPFFDFSTGFFVSELTFFFVSISEQSPSGP*YSSCISFKYAS*SLNIGVKMHKGVSSTC 79 + P+F ++G S + F + I + P Y SC ++++ L I + +H G+SSTC Sbjct: 791 RAPYFSCASGIS-STCSLFLLCIQASAVRAP-YFSC-AYRHQQYVLLISL-VHTGISSTC 846 Query: 78 FL 73 L Sbjct: 847 SL 848 >SB_10762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 647 Score = 28.3 bits (60), Expect = 6.6 Identities = 16/55 (29%), Positives = 25/55 (45%) Frame = +2 Query: 77 KHVDETPLCILTPIFRDYEAYLKEIQEEYHGPDGDCSEIETKKNVNSETKNPVEK 241 + + E L P+F+D EA KE EE+ D ++ KK+ + EK Sbjct: 447 REIWEGSLNTTKPVFKDLEAQFKERTEEFEKMKKDVVGLKNKKSSLETSVQRAEK 501 >SB_43491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -2 Query: 463 RSPKREPCAYCWNAIYSACSC 401 R P YCWN I SA SC Sbjct: 78 RRPNSTTVDYCWNTIISAYSC 98 >SB_30605| Best HMM Match : DUF601 (HMM E-Value=1.7) Length = 329 Score = 27.9 bits (59), Expect = 8.8 Identities = 19/74 (25%), Positives = 33/74 (44%) Frame = +2 Query: 131 EAYLKEIQEEYHGPDGDCSEIETKKNVNSETKNPVEKSKNGIFSESSRDLTVSGSSIFKL 310 EA EI+ H P CS+ +T V S PV K+ + + + S ++ + S + Sbjct: 99 EATSSEIENPSHVPRDSCSKSQTFNPVRSGV--PVSKNLSNLRKDFSSEILIDTSITIQR 156 Query: 311 DPSKPFSTTPLSSS 352 + T L+S+ Sbjct: 157 FSNSKIKTCNLTST 170 >SB_24810| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 497 Score = 27.9 bits (59), Expect = 8.8 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -1 Query: 644 CKFYFWRYIFHLPDLRALYYL 582 CKFY Y+F+L DL Y L Sbjct: 210 CKFYTGVYLFNLDDLEVFYQL 230 >SB_5064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 711 Score = 27.9 bits (59), Expect = 8.8 Identities = 16/51 (31%), Positives = 26/51 (50%) Frame = +2 Query: 125 DYEAYLKEIQEEYHGPDGDCSEIETKKNVNSETKNPVEKSKNGIFSESSRD 277 DY++ K + E + P C T+ N+ S +NP + NG SES+ + Sbjct: 464 DYDSSFKHLLYELN-PALSCCLDTTEDNLISHIENPSKLHSNGRISESTSE 513 >SB_40530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1033 Score = 27.9 bits (59), Expect = 8.8 Identities = 22/49 (44%), Positives = 30/49 (61%), Gaps = 2/49 (4%) Frame = +2 Query: 107 LTPIFRDYEAYLKEIQEEYHGPDGDCS-EI-ETKKNVNSETKNPVEKSK 247 +TP+ RDY LKE ++ D D S E+ ETKK V ETK V+++K Sbjct: 172 VTPLERDYVTLLKEWVDK----DLDLSKEVNETKKEV-QETKKEVQETK 215 >SB_35866| Best HMM Match : TPR_MLP1_2 (HMM E-Value=0.34) Length = 758 Score = 27.9 bits (59), Expect = 8.8 Identities = 23/83 (27%), Positives = 38/83 (45%), Gaps = 1/83 (1%) Frame = +2 Query: 125 DYEAYLKEIQEEYHGPDGDCSEIETKKNVNSETKNPVEKSKNGIFSESSRDLTVSG-SSI 301 +YE ++E+Q E +C E++ N N ++ V++ G E + DL + G S Sbjct: 442 EYEGQIRELQNENLDLRKECLELD---NENKILEDEVKQLSEGSTPEGN-DLDIYGRSEK 497 Query: 302 FKLDPSKPFSTTPLSSSCNMLGD 370 LD P S+ L + L D Sbjct: 498 LCLDDEVPISSCELEAFETRLSD 520 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,116,524 Number of Sequences: 59808 Number of extensions: 362431 Number of successful extensions: 1245 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1241 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1913853903 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -