BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30402 (719 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974170-1|ABJ52810.1| 511|Anopheles gambiae serpin 12 protein. 28 0.33 EF588439-1|ABQ96675.1| 177|Anopheles gambiae transposase protein. 25 1.8 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 25 3.1 Z22930-6|CAA80518.1| 277|Anopheles gambiae trypsin protein. 24 4.1 Z18890-1|CAA79328.1| 277|Anopheles gambiae trypsin protein. 24 4.1 AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 24 4.1 AY391745-1|AAR28995.1| 460|Anopheles gambiae putative GPCR prot... 24 5.4 EF588570-1|ABQ96768.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588473-1|ABQ96709.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588472-1|ABQ96708.1| 176|Anopheles gambiae transposase protein. 23 7.2 DQ974168-1|ABJ52808.1| 447|Anopheles gambiae serpin 9 protein. 23 7.2 AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 23 9.5 >DQ974170-1|ABJ52810.1| 511|Anopheles gambiae serpin 12 protein. Length = 511 Score = 27.9 bits (59), Expect = 0.33 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +2 Query: 143 KEIQEEYHGPDGDCSEIETKKNVNSETKNPVE 238 +EI EE +GPDGD +E N NS +K+ V+ Sbjct: 101 EEIIEESNGPDGDNLVLEQGSN-NSNSKDIVD 131 >EF588439-1|ABQ96675.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.4 bits (53), Expect = 1.8 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +2 Query: 200 KKNVNSETKNPVEKSKNGIFSESSRDLTVSGSSIFK 307 KK +NSETK +++ G+ + + S IFK Sbjct: 97 KKPINSETKKVLDRMLLGLICKECLPFNLVESEIFK 132 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 24.6 bits (51), Expect = 3.1 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -1 Query: 683 TALVKNTVFFSNWCKFYFWRYIFHL 609 +ALV NT+F S + F +Y HL Sbjct: 2053 SALVNNTIFASLAVRHGFHKYFLHL 2077 >Z22930-6|CAA80518.1| 277|Anopheles gambiae trypsin protein. Length = 277 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -1 Query: 197 SQFQSNHHLVHDTLPVFL 144 +Q HHLVH LP FL Sbjct: 22 AQPSGRHHLVHPLLPRFL 39 >Z18890-1|CAA79328.1| 277|Anopheles gambiae trypsin protein. Length = 277 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -1 Query: 197 SQFQSNHHLVHDTLPVFL 144 +Q HHLVH LP FL Sbjct: 22 AQPSGRHHLVHPLLPRFL 39 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 24.2 bits (50), Expect = 4.1 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = -3 Query: 564 DGAPNLRGEPSEDG 523 DG P LRGEP G Sbjct: 621 DGTPGLRGEPGPKG 634 >AY391745-1|AAR28995.1| 460|Anopheles gambiae putative GPCR protein. Length = 460 Score = 23.8 bits (49), Expect = 5.4 Identities = 8/23 (34%), Positives = 16/23 (69%) Frame = -2 Query: 700 FFTNTLQRLSKTLFSSAIGVNST 632 FF L++LS + + +A+G++ T Sbjct: 64 FFNTKLKKLSSSYYLAALGISDT 86 >EF588570-1|ABQ96768.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.4 bits (48), Expect = 7.2 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +2 Query: 200 KKNVNSETKNPVEKSKNGIFSESSRDLTVSGSSIFK 307 KK +NSETK +++ + + + S IFK Sbjct: 96 KKPINSETKKVLDRMLLDLICKECLPFNLEESEIFK 131 >EF588473-1|ABQ96709.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.4 bits (48), Expect = 7.2 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +2 Query: 200 KKNVNSETKNPVEKSKNGIFSESSRDLTVSGSSIFK 307 KK +NSETK +++ + + + S IFK Sbjct: 96 KKPINSETKKVLDRMLLDLICKECLPFNLEESEIFK 131 >EF588472-1|ABQ96708.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.4 bits (48), Expect = 7.2 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +2 Query: 200 KKNVNSETKNPVEKSKNGIFSESSRDLTVSGSSIFK 307 KK +NSETK +++ + + + S IFK Sbjct: 96 KKPINSETKKVLDRMLLDLICKECLPFNLEESEIFK 131 >DQ974168-1|ABJ52808.1| 447|Anopheles gambiae serpin 9 protein. Length = 447 Score = 23.4 bits (48), Expect = 7.2 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = +2 Query: 161 YHGPDGDCSEIETKKNVNSETKNPVEKSKNGIFSESS 271 +HG +G CS + KK +E +E+S++ ++ S Sbjct: 23 HHGTNGQCSPGDEKK---AEKATDLEQSRSRLYKGES 56 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 23.0 bits (47), Expect = 9.5 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -1 Query: 203 FLSQFQSNHHLVHDTLPVF 147 +LSQ S H VH+ L VF Sbjct: 926 YLSQVLSGHAFVHEFLHVF 944 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 666,571 Number of Sequences: 2352 Number of extensions: 13667 Number of successful extensions: 275 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 273 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 275 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73181328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -