BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30399 (744 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15721| Best HMM Match : No HMM Matches (HMM E-Value=.) 155 4e-38 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_25662| Best HMM Match : HLH (HMM E-Value=2.3e-14) 89 3e-18 SB_23556| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 9e-11 SB_50387| Best HMM Match : HLH (HMM E-Value=8.2e-05) 64 2e-10 SB_27523| Best HMM Match : 7tm_1 (HMM E-Value=3.5e-09) 60 2e-09 SB_33294| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 6e-09 SB_58721| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_744| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_33613| Best HMM Match : PAS (HMM E-Value=0.0083) 42 4e-04 SB_30776| Best HMM Match : HLH (HMM E-Value=1.7e-13) 40 0.003 SB_59476| Best HMM Match : HLH (HMM E-Value=1.2e-15) 39 0.005 SB_40771| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.026 SB_7690| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_44696| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_58894| Best HMM Match : HLH (HMM E-Value=0.032) 32 0.56 SB_16650| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.56 SB_28816| Best HMM Match : PAS (HMM E-Value=0.0047) 31 0.75 SB_9409| Best HMM Match : HLH (HMM E-Value=5.8e-17) 31 0.75 SB_22384| Best HMM Match : HLH (HMM E-Value=2.7e-12) 31 0.99 SB_10010| Best HMM Match : HLH (HMM E-Value=8.5e-09) 31 0.99 SB_2479| Best HMM Match : SecA_PP_bind (HMM E-Value=0.94) 30 2.3 SB_49489| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_44015| Best HMM Match : TPR_2 (HMM E-Value=7.3e-07) 29 3.0 SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_12077| Best HMM Match : TPR_1 (HMM E-Value=1.3) 29 5.3 SB_38786| Best HMM Match : HLH (HMM E-Value=1e-13) 29 5.3 >SB_15721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 155 bits (376), Expect = 4e-38 Identities = 73/129 (56%), Positives = 97/129 (75%) Frame = +2 Query: 263 KYTRMEEDNIQDKERFASRENHCEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTIL 442 K ++ + + ++ A ++NH EIE+RRR+KM YI ELS M+P C+A++RK DKLT+L Sbjct: 167 KVAGLDSGDSKGFQKGAIKQNHSEIEKRRRDKMNTYINELSTMIPMCNAMSRKLDKLTVL 226 Query: 443 RMAVAHMKALRGTGNTSTDGTYKPSFLTDQELKHLILEAADGFLFVVSCDTGRIIYVSDS 622 RMAV HM+ALRG T+ YKP+FL+D++LK+L+LEAADGFLFVV CD GRI+YVSDS Sbjct: 227 RMAVQHMRALRGRAVPFTETNYKPAFLSDEDLKNLVLEAADGFLFVVGCDRGRILYVSDS 286 Query: 623 IAPVLNYSQ 649 I L SQ Sbjct: 287 IQNSLYLSQ 295 >SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 100 bits (239), Expect = 1e-21 Identities = 49/67 (73%), Positives = 57/67 (85%) Frame = +2 Query: 278 EEDNIQDKERFASRENHCEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVA 457 + +N++DK FA RENH EIERRRRNKM AYI ELSDMVP+C+ LARKPDKLT+LRMAV Sbjct: 4 DPENVKDK--FA-RENHSEIERRRRNKMNAYINELSDMVPSCTGLARKPDKLTVLRMAVN 60 Query: 458 HMKALRG 478 +MK LRG Sbjct: 61 YMKTLRG 67 Score = 32.7 bits (71), Expect = 0.32 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +2 Query: 596 GRIIYVSDSIAPVLNYSQGEWYSSCLYDQVHPDDVEKVRE 715 G+ +V + VL Y + YD HPDD+E + E Sbjct: 255 GKFTFVDQRVTEVLGYQPRDMLGQLCYDFFHPDDLEHMME 294 >SB_25662| Best HMM Match : HLH (HMM E-Value=2.3e-14) Length = 468 Score = 89.4 bits (212), Expect = 3e-18 Identities = 50/143 (34%), Positives = 81/143 (56%), Gaps = 2/143 (1%) Frame = +2 Query: 317 RENHCEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVAHMKALRG--TGNT 490 R E E+RRR+K+ YITEL+ MVP C++ +K DK T+L+MAV +MK T Sbjct: 139 RTTRNESEKRRRDKLNVYITELAAMVPMCASSRKKLDKTTVLQMAVNYMKIHNDLTTSVL 198 Query: 491 STDGTYKPSFLTDQELKHLILEAADGFLFVVSCDTGRIIYVSDSIAPVLNYSQGEWYSSC 670 + + + SFL+ E+ ++ E +GFLF +S G + ++S ++ + + Q E Sbjct: 199 AKEPAVQSSFLSGDEVGEILDECMNGFLFALS-SNGAVTFISRNVFQLFGHKQEEVIGKN 257 Query: 671 LYDQVHPDDVEKVREQLSTQEPQ 739 D +HPDD V +LS ++P+ Sbjct: 258 FLDLIHPDDRNLVFNKLS-EDPE 279 >SB_23556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 671 Score = 64.5 bits (150), Expect = 9e-11 Identities = 43/140 (30%), Positives = 75/140 (53%), Gaps = 3/140 (2%) Frame = +2 Query: 311 ASRENHCEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVAHMKALRGTGNT 490 + R N E++RR++ I EL+ ++ S +RK DK T+L+ A+A +K+ + Sbjct: 21 SKRVNRNMNEKKRRDRFNVLIGELASII---SPSSRKVDKSTVLKKAIACLKSQKDLSPA 77 Query: 491 STDGT---YKPSFLTDQELKHLILEAADGFLFVVSCDTGRIIYVSDSIAPVLNYSQGEWY 661 S ++P F++D EL LI+EA DGF+ + +G I +VSD+I L Y + Sbjct: 78 SCSKPREGWQPPFVSDPELCQLIIEAMDGFIMSID-SSGSISFVSDNITSQLGYLPEKII 136 Query: 662 SSCLYDQVHPDDVEKVREQL 721 ++ L + + D E + +L Sbjct: 137 NTRLSEYLESRDCEAMDVRL 156 Score = 29.1 bits (62), Expect = 4.0 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 632 VLNYSQGEWYSSCLYDQVHPDDVEKV 709 V+ Y E S LY +HP+D+E + Sbjct: 276 VIGYMSNELVGSSLYQNIHPNDLENI 301 >SB_50387| Best HMM Match : HLH (HMM E-Value=8.2e-05) Length = 791 Score = 63.7 bits (148), Expect = 2e-10 Identities = 40/134 (29%), Positives = 71/134 (52%), Gaps = 6/134 (4%) Frame = +2 Query: 341 RRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVAHMKA-----LRG-TGNTSTDG 502 +R R+++ A + L+ ++P K DK++ILR+ V++++A + G G T Sbjct: 87 KRHRDRLNAELDNLARLLPFPEETVTKLDKISILRLTVSYLRAKSFFQVNGKNGQEETCE 146 Query: 503 TYKPSFLTDQELKHLILEAADGFLFVVSCDTGRIIYVSDSIAPVLNYSQGEWYSSCLYDQ 682 F + L LEA DGF+ V++ D G++ YVS+++ L YSQ +Y Sbjct: 147 DLVREFEGNGLFSQLSLEALDGFIVVITQD-GQLFYVSENVRDFLGYSQAAVIHQSIYKF 205 Query: 683 VHPDDVEKVREQLS 724 +H DD + V+ +L+ Sbjct: 206 LHIDDQDMVKLKLA 219 >SB_27523| Best HMM Match : 7tm_1 (HMM E-Value=3.5e-09) Length = 666 Score = 59.7 bits (138), Expect = 2e-09 Identities = 37/132 (28%), Positives = 66/132 (50%) Frame = +2 Query: 341 RRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVAHMKALRGTGNTSTDGTYKPSF 520 R RR + ELS +P +++ + D+L I+R+ +++K R G + + Sbjct: 475 RSRRGQQNDEFAELSHQLPLPKSISSQLDRLCIMRLTNSYIKIKRLLSTMMNQGIHGNNL 534 Query: 521 LTDQELKHLILEAADGFLFVVSCDTGRIIYVSDSIAPVLNYSQGEWYSSCLYDQVHPDDV 700 +A DGF++V++ D G+ +Y+S+++ L SQ E + LY VHP D Sbjct: 535 SLFHPFND---KALDGFVYVIAQD-GQCLYISENVTYYLGLSQIEVTGNSLYKYVHPCDH 590 Query: 701 EKVREQLSTQEP 736 E++ QL + P Sbjct: 591 EELANQLGGRIP 602 >SB_33294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 983 Score = 58.4 bits (135), Expect = 6e-09 Identities = 36/122 (29%), Positives = 65/122 (53%), Gaps = 11/122 (9%) Frame = +2 Query: 317 RENHCEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVAHMKALRGTGNTST 496 +E + R RR K A EL+ ++P +A+ + DK +I+R+ ++++ GN +T Sbjct: 53 KERSRDAARNRRGKENAQFDELARLLPLPAAITSQLDKASIVRLTISYLSMREFAGNCNT 112 Query: 497 DGTYK-----------PSFLTDQELKHLILEAADGFLFVVSCDTGRIIYVSDSIAPVLNY 643 DG+ S +E + +L+A DGFL V+S G+I+Y+S++++ L Sbjct: 113 DGSSSSKEVVAYNSNAQSSSMPEETGNQLLQAMDGFLMVLS-QEGKILYISETVSVNLGL 171 Query: 644 SQ 649 SQ Sbjct: 172 SQ 173 >SB_58721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 40 Score = 45.2 bits (102), Expect = 6e-05 Identities = 16/26 (61%), Positives = 22/26 (84%) Frame = +2 Query: 656 WYSSCLYDQVHPDDVEKVREQLSTQE 733 W + CLYD +HP+DVEKVR+QLS+ + Sbjct: 3 WMNQCLYDLIHPEDVEKVRDQLSSSD 28 >SB_744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 44.0 bits (99), Expect = 1e-04 Identities = 21/60 (35%), Positives = 30/60 (50%) Frame = +2 Query: 560 ADGFLFVVSCDTGRIIYVSDSIAPVLNYSQGEWYSSCLYDQVHPDDVEKVREQLSTQEPQ 739 A G F+V + G + Y+S++ + L YSQ VHPDDVE +E L P+ Sbjct: 1 AIGGFFIVLTEGGNVFYISENSSSYLGYSQAHMMHQDFLTYVHPDDVESFKECLGRPLPE 60 >SB_33613| Best HMM Match : PAS (HMM E-Value=0.0083) Length = 624 Score = 42.3 bits (95), Expect = 4e-04 Identities = 20/57 (35%), Positives = 35/57 (61%) Frame = +2 Query: 554 EAADGFLFVVSCDTGRIIYVSDSIAPVLNYSQGEWYSSCLYDQVHPDDVEKVREQLS 724 +A DGF+ V++ D G++ YVS+++ L YSQ +Y +H DD + V+ +L+ Sbjct: 30 QALDGFIVVITQD-GQLFYVSENVRDFLGYSQAAVIHQSIYKFLHIDDQDMVKLKLA 85 Score = 31.9 bits (69), Expect = 0.56 Identities = 14/31 (45%), Positives = 22/31 (70%) Frame = +2 Query: 557 AADGFLFVVSCDTGRIIYVSDSIAPVLNYSQ 649 A DGF+ V++ D G++ YVS+++ L YSQ Sbjct: 1 ALDGFIVVITQD-GQLFYVSENVRDFLGYSQ 30 >SB_30776| Best HMM Match : HLH (HMM E-Value=1.7e-13) Length = 1217 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/47 (38%), Positives = 32/47 (68%) Frame = +2 Query: 326 HCEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVAHMK 466 H E+ERRR++K+ +IT+L+++VP C+ K K +L +V ++K Sbjct: 142 HNEVERRRKDKINNWITKLAEVVPDCA--RGKQSKNIVLEKSVEYLK 186 >SB_59476| Best HMM Match : HLH (HMM E-Value=1.2e-15) Length = 272 Score = 38.7 bits (86), Expect = 0.005 Identities = 24/73 (32%), Positives = 39/73 (53%), Gaps = 5/73 (6%) Frame = +2 Query: 335 IERRRRNKMTAYITELSDMVPTC--SALARKPDKLTILRMAVAHMKALRGTGNTST---D 499 IE++RR+++ + EL +VPT + K +K IL + V H+K LR T S D Sbjct: 19 IEKKRRDRINRCLVELRRLVPTALEKEGSSKLEKAEILHLTVEHLKWLRSTSGQSRSEYD 78 Query: 500 GTYKPSFLTDQEL 538 + P+ T+Q + Sbjct: 79 IGFAPTVCTEQSV 91 >SB_40771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 553 Score = 36.3 bits (80), Expect = 0.026 Identities = 19/49 (38%), Positives = 28/49 (57%) Frame = +2 Query: 317 RENHCEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVAHM 463 +E H E ER+RR ++ L M+P+CS A DK T+ M VA++ Sbjct: 482 KEAHLEKERKRRERIARSWFLLRSMIPSCSDTA---DKATVFEMTVAYI 527 >SB_7690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 430 Score = 33.9 bits (74), Expect = 0.14 Identities = 19/54 (35%), Positives = 29/54 (53%) Frame = +2 Query: 314 SRENHCEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVAHMKALR 475 +R H +ER+RRN + +L D VP R P K++ILR + H+ L+ Sbjct: 347 TRATHNVLERKRRNDLKLKFQKLRDAVPELKDNERAP-KVSILRKSWEHIVQLK 399 >SB_44696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 695 Score = 33.5 bits (73), Expect = 0.18 Identities = 14/39 (35%), Positives = 25/39 (64%) Frame = +2 Query: 341 RRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVA 457 RR R K+ + ELS ++P + +K DKL++L++ V+ Sbjct: 132 RRHREKLNTVLDELSLLLPLDGTVKKKLDKLSVLKLTVS 170 >SB_58894| Best HMM Match : HLH (HMM E-Value=0.032) Length = 34 Score = 31.9 bits (69), Expect = 0.56 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +2 Query: 314 SRENHCEIERRRRNKMTAYITELSDMV 394 +R NH EIE+R RN + I EL D+V Sbjct: 2 NRSNHNEIEKRYRNSINNRINELKDLV 28 >SB_16650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1264 Score = 31.9 bits (69), Expect = 0.56 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +2 Query: 314 SRENHCEIERRRRNKMTAYITELSDMV 394 +R NH EIE+R RN + I EL D+V Sbjct: 406 NRSNHNEIEKRYRNSINNRINELKDLV 432 >SB_28816| Best HMM Match : PAS (HMM E-Value=0.0047) Length = 405 Score = 31.5 bits (68), Expect = 0.75 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +2 Query: 596 GRIIYVSDSIAPVLNYSQGEWYSSCLYDQVHPDDVEKVRE 715 G+ IYV I + Y E + YD HP+D+E V + Sbjct: 85 GKFIYVDQRIVSICGYLPQEVIGTSGYDYFHPEDLEIVAQ 124 >SB_9409| Best HMM Match : HLH (HMM E-Value=5.8e-17) Length = 362 Score = 31.5 bits (68), Expect = 0.75 Identities = 19/55 (34%), Positives = 29/55 (52%) Frame = +2 Query: 311 ASRENHCEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVAHMKALR 475 + R H +ER+RRN + +L VP R P K+TILR A +++ L+ Sbjct: 279 SKRAVHNVLERKRRNDLKTSFHQLRAEVPELEENERSP-KVTILRKARDYVEQLK 332 >SB_22384| Best HMM Match : HLH (HMM E-Value=2.7e-12) Length = 323 Score = 31.1 bits (67), Expect = 0.99 Identities = 18/58 (31%), Positives = 28/58 (48%) Frame = +2 Query: 278 EEDNIQDKERFASRENHCEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMA 451 +E D E R +H ++ER+RRN++ + L +P K K+ ILR A Sbjct: 225 DEQTSSDSEPDNFRISHNDLERKRRNELRSRFNSLRKSIPELEN-NEKTAKIAILRKA 281 >SB_10010| Best HMM Match : HLH (HMM E-Value=8.5e-09) Length = 227 Score = 31.1 bits (67), Expect = 0.99 Identities = 17/62 (27%), Positives = 33/62 (53%), Gaps = 3/62 (4%) Frame = +2 Query: 269 TRMEEDNIQDKERFAS--RENHCEIERRRRNKMTAYITELSDMVPT-CSALARKPDKLTI 439 ++ + + D+E++ R +H E++RR + +L+ MVPT S + K K T+ Sbjct: 3 SKTQRTKVSDREQYKEHRRMSHISAEQKRRCNIKMGFDQLASMVPTLASQKSSKVSKATV 62 Query: 440 LR 445 L+ Sbjct: 63 LQ 64 >SB_2479| Best HMM Match : SecA_PP_bind (HMM E-Value=0.94) Length = 327 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/49 (24%), Positives = 26/49 (53%) Frame = +3 Query: 144 ESVDRCLP*LQLSPGLTQQRIYKNAVLAVLDQMKTTEVVENTQGWRRTI 290 +SV CLP L+LSP +++ + + +++ +V+ Q W + + Sbjct: 192 QSVTDCLPILKLSPSPKSAQVHATLLWSAGQELQALQVLLRHQAWHQAV 240 >SB_49489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 485 Score = 29.5 bits (63), Expect = 3.0 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = +2 Query: 620 SIAPVLNYSQGEWYSSCLYDQVHPDDVEKVREQLSTQEPQN 742 S+ P L+ G+ Y+S L+DQV ++ Q +T + +N Sbjct: 140 SVLPELSEYHGKLYTSMLHDQVSVQHAMSLQSQFATYQERN 180 >SB_44015| Best HMM Match : TPR_2 (HMM E-Value=7.3e-07) Length = 635 Score = 29.5 bits (63), Expect = 3.0 Identities = 26/121 (21%), Positives = 52/121 (42%), Gaps = 2/121 (1%) Frame = +2 Query: 287 NIQDKERFASRENHCEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVAHM- 463 N+ D+ER + + H E E ++ +K A +++L++M P + + + Sbjct: 22 NLTDQERELANQAHIEYEGQQYDKSLAALSKLNEMRPNDYKVVHNKAIIQYCLTGLTRTD 81 Query: 464 KALRGTGNTSTDGTYK-PSFLTDQELKHLILEAADGFLFVVSCDTGRIIYVSDSIAPVLN 640 + + GNT G K P+ + + E E+ + V + + Y D + VLN Sbjct: 82 EFFQSLGNTQEKGMLKTPADMIEHESGDSKDESDVLDMVYVLYNEAVVCYNPDKASAVLN 141 Query: 641 Y 643 + Sbjct: 142 H 142 >SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 29.5 bits (63), Expect = 3.0 Identities = 18/61 (29%), Positives = 33/61 (54%) Frame = -3 Query: 202 LCWVSPGDSWSYGRHRSTDSLPLVQVLISLRLIVIKYFIHNS*MFPTIT*NKYLQYFTRH 23 L WV+PG S S R ++T S L + + R + +F+ + + + +YL +FTR+ Sbjct: 30 LSWVTPGFSQSR-RCKTTASAKLACLQVDSRGSPVIFFVFKTQFETSHSYEEYLSFFTRN 88 Query: 22 K 20 + Sbjct: 89 R 89 >SB_12077| Best HMM Match : TPR_1 (HMM E-Value=1.3) Length = 123 Score = 28.7 bits (61), Expect = 5.3 Identities = 12/37 (32%), Positives = 24/37 (64%) Frame = +2 Query: 287 NIQDKERFASRENHCEIERRRRNKMTAYITELSDMVP 397 N+ D+ER + + H E E ++ +K A +++L++M P Sbjct: 22 NLTDQERELANQAHIEYEGQQYDKSLAALSKLNEMRP 58 >SB_38786| Best HMM Match : HLH (HMM E-Value=1e-13) Length = 817 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +2 Query: 281 EDNIQDKERFASRENHCEIERRRRNKMTAYITELSDMVP 397 + N+ ++R ++NH IERRRR + I EL M+P Sbjct: 320 DPNMLARDR-QKKDNHNMIERRRRFNINDRIKELGTMLP 357 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,049,098 Number of Sequences: 59808 Number of extensions: 460541 Number of successful extensions: 1627 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 1463 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1619 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2010148439 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -