BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30397 (579 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY341224-1|AAR13788.1| 287|Anopheles gambiae TOLL9 protein. 23 5.4 AY341223-1|AAR13787.1| 287|Anopheles gambiae TOLL9 protein. 23 5.4 AY341222-1|AAR13786.1| 287|Anopheles gambiae TOLL9 protein. 23 5.4 AY341221-1|AAR13785.1| 287|Anopheles gambiae TOLL9 protein. 23 5.4 AY341220-1|AAR13784.1| 287|Anopheles gambiae TOLL9 protein. 23 5.4 AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. 23 5.4 AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 23 9.5 >AY341224-1|AAR13788.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.4 bits (48), Expect = 5.4 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = -2 Query: 254 LNLIRTFILIVLCSILFKFTRITMIKNLNNVIKCIITN*FNYFEYILFN 108 +NL I+I+ +L+ F+R++ + N I+C N + IL N Sbjct: 6 VNLRNNSIVILTTDMLYDFSRLSAMGLGGNTIQC-SCNYVKFLRNILHN 53 >AY341223-1|AAR13787.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.4 bits (48), Expect = 5.4 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = -2 Query: 254 LNLIRTFILIVLCSILFKFTRITMIKNLNNVIKCIITN*FNYFEYILFN 108 +NL I+I+ +L+ F+R++ + N I+C N + IL N Sbjct: 6 VNLRNNSIVILTTDMLYDFSRLSAMGLGGNTIQC-SCNYVKFLRNILHN 53 >AY341222-1|AAR13786.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.4 bits (48), Expect = 5.4 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = -2 Query: 254 LNLIRTFILIVLCSILFKFTRITMIKNLNNVIKCIITN*FNYFEYILFN 108 +NL I+I+ +L+ F+R++ + N I+C N + IL N Sbjct: 6 VNLRNNSIVILTTDMLYDFSRLSAMGLGGNTIQC-SCNYVKFLRNILHN 53 >AY341221-1|AAR13785.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.4 bits (48), Expect = 5.4 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = -2 Query: 254 LNLIRTFILIVLCSILFKFTRITMIKNLNNVIKCIITN*FNYFEYILFN 108 +NL I+I+ +L+ F+R++ + N I+C N + IL N Sbjct: 6 VNLRNNSIVILTTDMLYDFSRLSAMGLGGNTIQC-SCNYVKFLRNILHN 53 >AY341220-1|AAR13784.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.4 bits (48), Expect = 5.4 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = -2 Query: 254 LNLIRTFILIVLCSILFKFTRITMIKNLNNVIKCIITN*FNYFEYILFN 108 +NL I+I+ +L+ F+R++ + N I+C N + IL N Sbjct: 6 VNLRNNSIVILTTDMLYDFSRLSAMGLGGNTIQC-SCNYVKFLRNILHN 53 >AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. Length = 576 Score = 23.4 bits (48), Expect = 5.4 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = -2 Query: 254 LNLIRTFILIVLCSILFKFTRITMIKNLNNVIKCIITN*FNYFEYILFN 108 +NL I+I+ +L+ F+R++ + N I+C N + IL N Sbjct: 233 VNLRNNSIVILTTDMLYDFSRLSAMGLGGNTIQC-SCNYVKFLRNILHN 280 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 22.6 bits (46), Expect = 9.5 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -2 Query: 203 KFTRITMIKNLNNVIKCIIT 144 K+ +T + NLN V+ +IT Sbjct: 533 KYRPLTCLSNLNKVLSSVIT 552 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 461,632 Number of Sequences: 2352 Number of extensions: 8556 Number of successful extensions: 10 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55086417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -