BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30393 (751 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g23180.1 68414.m02896 armadillo/beta-catenin repeat family pr... 30 1.9 At5g63930.1 68418.m08028 leucine-rich repeat transmembrane prote... 29 2.5 At2g04300.1 68415.m00422 leucine-rich repeat protein kinase, put... 29 3.3 At1g30530.1 68414.m03735 UDP-glucoronosyl/UDP-glucosyl transfera... 29 3.3 >At1g23180.1 68414.m02896 armadillo/beta-catenin repeat family protein contains Pfam profile: PF00514 armadillo/beta-catenin-like repeat Length = 834 Score = 29.9 bits (64), Expect = 1.9 Identities = 15/65 (23%), Positives = 33/65 (50%) Frame = -2 Query: 225 DSQEVLTPVITQIIIWRV*FLLHDVIPSPWKSIVNICLVRISLQKMVPASGIRTPVHRKI 46 DS+ + T + I V +L +P +K V CLV+++ P+ + P++ ++ Sbjct: 659 DSESFRQTIDTAVFIELVRKILRSSLPLHYKDWVAACLVKLTALSS-PSQSLNNPINLEV 717 Query: 45 RIHRT 31 +++T Sbjct: 718 TLYKT 722 >At5g63930.1 68418.m08028 leucine-rich repeat transmembrane protein kinase, putative Length = 1102 Score = 29.5 bits (63), Expect = 2.5 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 2/47 (4%) Frame = -1 Query: 322 GLSIVTTAALPFKPKRINASR--QKWAGGDTYPCGLTRGLNTSNYAN 188 GL++ L K K ++A + + W D+ PCG T G+ SNY++ Sbjct: 26 GLNLEGQYLLEIKSKFVDAKQNLRNWNSNDSVPCGWT-GVMCSNYSS 71 >At2g04300.1 68415.m00422 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 851 Score = 29.1 bits (62), Expect = 3.3 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 544 TYFSK*PPFNNTHSLVP*NGQRYSYRH 624 T SK PFN T SL+P + YSY H Sbjct: 258 TPISKNAPFNFTWSLIPSTAKFYSYMH 284 >At1g30530.1 68414.m03735 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 453 Score = 29.1 bits (62), Expect = 3.3 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -2 Query: 576 IVERRLFTKVGYSKCLNILFVFPD 505 +++ +FTK G+ KCLN +FV D Sbjct: 391 MMDNGVFTKEGFEKCLNDVFVHDD 414 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,613,779 Number of Sequences: 28952 Number of extensions: 312493 Number of successful extensions: 537 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 528 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 537 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1663169840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -