BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30392 (657 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 25 0.84 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 25 0.84 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 24 1.1 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 23 2.6 DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II lar... 23 3.4 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.6 bits (51), Expect = 0.84 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 4/25 (16%) Frame = -3 Query: 226 FRC*TPPRPSHRFIRP----FRWPL 164 FRC PP P RFI P FR PL Sbjct: 148 FRCIGPPTPFPRFIPPNAYRFRPPL 172 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 24.6 bits (51), Expect = 0.84 Identities = 7/27 (25%), Positives = 20/27 (74%) Frame = +1 Query: 529 LVESLLGKAQTDYKNKIKKDVVLKVDT 609 +V+++ G +KN++++++ +K+DT Sbjct: 58 IVKAISGVQTVRFKNELERNITIKLDT 84 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 24.2 bits (50), Expect = 1.1 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +3 Query: 72 VSGVKNKQQPWRSAMQYVQKQYQAHDGLH 158 ++ V+ QQ + A Q + Q+H GLH Sbjct: 786 MAAVQQSQQRHQHAAQMIYGHQQSHHGLH 814 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 23.0 bits (47), Expect = 2.6 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -1 Query: 576 LILVVCLGFSEQGL 535 L+LVVCLG + QG+ Sbjct: 5 LLLVVCLGIACQGI 18 >DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II large subunit protein. Length = 296 Score = 22.6 bits (46), Expect = 3.4 Identities = 16/60 (26%), Positives = 27/60 (45%) Frame = +1 Query: 412 EVPKDTKLYSXLLVTLIVQALFQLMEPTVTIRVRQTDKALVESLLGKAQTDYKNKIKKDV 591 E+ K K ++ +I +A +EPT +RQT + V +L A+ KK + Sbjct: 162 EIQKXIKKAKEDVIEVIQKAHNMELEPTPGNTLRQTFENQVNRILNDARDKTGGSAKKSL 221 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,961 Number of Sequences: 438 Number of extensions: 3271 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19734030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -