BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30391 (793 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g65200.1 68414.m07392 ubiquitin carboxyl-terminal hydrolase-r... 30 2.0 At3g56930.1 68416.m06332 zinc finger (DHHC type) family protein ... 28 8.2 >At1g65200.1 68414.m07392 ubiquitin carboxyl-terminal hydrolase-related contains Pfam profiles PF00443: Ubiquitin carboxyl-terminal hydrolase, PF04780: Protein of unknown function (DUF629), PF04781: Protein of unknown function (DUF627) Length = 1101 Score = 29.9 bits (64), Expect = 2.0 Identities = 19/64 (29%), Positives = 33/64 (51%) Frame = +2 Query: 227 CGRRNTVRHMRNSCDGMFVRLVHF*FQNETIKRTNAPGSFSRLRHSVRSVRDFEILFVKT 406 CG+ N VRH +SC +F ++ + +NET K + G+ + + + +E L T Sbjct: 977 CGKANFVRHTISSCPPIFTIVLKW-EKNETEKEIS--GTLKAMDWEIDISKLYEGLEPNT 1033 Query: 407 NYNI 418 NY + Sbjct: 1034 NYRL 1037 >At3g56930.1 68416.m06332 zinc finger (DHHC type) family protein low similarity to Golgi-specific DHHC zinc figer protein [Mus musculus] GI:21728103; contains Pfam profile PF01529: DHHC zinc finger domain Length = 477 Score = 27.9 bits (59), Expect = 8.2 Identities = 12/38 (31%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +3 Query: 72 LRRGGDFCDWTHKFFGPGNFKIFHMFIGFARCVC-FVF 182 ++R C W + G N++ F MFI + +C +VF Sbjct: 169 VQRFDHHCPWVGQCIGVRNYRFFFMFISTSTTLCIYVF 206 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,173,444 Number of Sequences: 28952 Number of extensions: 243686 Number of successful extensions: 469 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 461 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 469 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1785055200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -