SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= maV30389
         (630 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

02_01_0759 - 5628913-5630870,5631023-5631047                           27   9.3  

>02_01_0759 - 5628913-5630870,5631023-5631047
          Length = 660

 Score = 27.5 bits (58), Expect = 9.3
 Identities = 10/37 (27%), Positives = 22/37 (59%)
 Frame = +1

Query: 301 ISVERCNRSNKSAIVNVRFVCSRLSTPDLSHCLCMEN 411
           +S+E C++   +++  +   C+ L+  DLS C+  +N
Sbjct: 555 VSLEGCSKITDASLFAISENCTELAELDLSKCMVSDN 591


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,293,684
Number of Sequences: 37544
Number of extensions: 323447
Number of successful extensions: 598
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 583
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 598
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1537558360
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -