BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30388 (627 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 24 0.91 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 24 0.91 Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor ... 23 1.6 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 22 3.7 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 22 4.8 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 21 6.4 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 21 6.4 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 24.2 bits (50), Expect = 0.91 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +1 Query: 571 PHPPPLQHTPAAPVPSP 621 PHPP L PA P P Sbjct: 238 PHPPHLSSHPAIVTPGP 254 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 24.2 bits (50), Expect = 0.91 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +1 Query: 571 PHPPPLQHTPAAPVPSP 621 PHPP L PA P P Sbjct: 130 PHPPHLSSHPAIVTPGP 146 >Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor 5-like protein protein. Length = 162 Score = 23.4 bits (48), Expect = 1.6 Identities = 17/70 (24%), Positives = 34/70 (48%), Gaps = 11/70 (15%) Frame = +2 Query: 167 EHAQNQTVLSTPQWTVQMR-----YYSSLPSHIKV------NLPALSPTMESGSIVSWEK 313 E+ + + ++ST + T+ Y+S L S+ K+ N P L+P ++ S+ ++ Sbjct: 17 ENPETELLVSTKRSTISQGCKACGYHSPLESNHKLVTFILKNPPNLNPAVQGSSLTEGKR 76 Query: 314 KEGDKLSEGD 343 + K GD Sbjct: 77 SKRSKRPNGD 86 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 22.2 bits (45), Expect = 3.7 Identities = 15/44 (34%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Frame = +2 Query: 200 PQWTVQMRYYSSLPSHIKVNLPALS---PTMESGSIVSWEKKEG 322 PQWT Q HIK +P +S +M GS W + G Sbjct: 54 PQWTWQCINQRCERRHIKGAIPVVSLSTCSMLCGSTQLWPQPTG 97 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 21.8 bits (44), Expect = 4.8 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +2 Query: 146 KVTNKLLEHAQNQTVLSTPQWTVQMRYYSSL 238 K NKL H T+L+ WT+ Y+ ++ Sbjct: 226 KKINKLYGHQLLLTILTYLIWTIYEMYHLAI 256 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.4 bits (43), Expect = 6.4 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +1 Query: 577 PPPLQHTPAAPVPSPAP 627 PPP A P PS +P Sbjct: 330 PPPPYQISAQPTPSQSP 346 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 21.4 bits (43), Expect = 6.4 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = +1 Query: 568 CPHPPPLQHTPAAPVPSPAP 627 C + PPL P P+P P Sbjct: 171 CNNYPPLPQVPPLPLPPIFP 190 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,520 Number of Sequences: 336 Number of extensions: 3463 Number of successful extensions: 17 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16083914 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -