BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30387 (729 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ304406-1|CAC35454.1| 131|Anopheles gambiae putative epidermal... 27 0.79 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 27 0.79 DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. 25 2.4 AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CY... 24 5.5 >AJ304406-1|CAC35454.1| 131|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 131 Score = 26.6 bits (56), Expect = 0.79 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = -3 Query: 280 ISAVHGIVITILYKTPEI*AKYLQVYSCK*TFSMTRW 170 I V G V+ LY P++ LQ+ + TF + +W Sbjct: 92 IREVTGYVLISLYDLPQVILPRLQIIRGRTTFKLNKW 128 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 26.6 bits (56), Expect = 0.79 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = -3 Query: 280 ISAVHGIVITILYKTPEI*AKYLQVYSCK*TFSMTRW 170 I V G V+ LY P++ LQ+ + TF + +W Sbjct: 52 IREVTGYVLISLYDLPQVILPRLQIIRGRTTFKLNKW 88 >DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. Length = 377 Score = 25.0 bits (52), Expect = 2.4 Identities = 10/27 (37%), Positives = 20/27 (74%), Gaps = 1/27 (3%) Frame = -2 Query: 101 SYNTK-IRPSNEDTFPSHASSLTIGLA 24 SYN+ +R + +T+P+ SSL++G++ Sbjct: 225 SYNSSGLRSYSSETYPNPGSSLSVGVS 251 >AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CYP9L1 protein protein. Length = 533 Score = 23.8 bits (49), Expect = 5.5 Identities = 12/26 (46%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = -2 Query: 401 LYLILTTISAFFKIYPVATV-APPLF 327 LY+ LT + FFK YP+ + PLF Sbjct: 18 LYVYLTHNNDFFKKYPIPCLPVEPLF 43 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 760,215 Number of Sequences: 2352 Number of extensions: 17679 Number of successful extensions: 18 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74428737 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -