BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30387 (729 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z99288-5|CAB16548.2| 336|Caenorhabditis elegans Hypothetical pr... 30 1.5 Z69646-7|CAA93471.3| 1484|Caenorhabditis elegans Hypothetical pr... 28 5.9 AF100670-2|AAN73857.3| 554|Caenorhabditis elegans Hypothetical ... 28 5.9 >Z99288-5|CAB16548.2| 336|Caenorhabditis elegans Hypothetical protein ZK262.6 protein. Length = 336 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = -1 Query: 480 FYFLISFKYNTFCDFVMFTGLSSFFISLSYSNNYQRLF*NLPCC 349 F ++++ N F L+ F I+LS S NY+ L CC Sbjct: 275 FNLILAYCSNLFSALFCANALAHFLINLSMSRNYRNAVMELGCC 318 >Z69646-7|CAA93471.3| 1484|Caenorhabditis elegans Hypothetical protein F57C7.4 protein. Length = 1484 Score = 28.3 bits (60), Expect = 5.9 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +3 Query: 195 LQEYTCKYFA*ISGVLYRIVMTIPWTAEIR 284 + EY K + GV+Y I +T+P+T E++ Sbjct: 1324 ISEYRFKNYKVFFGVVYNITVTLPFTDELK 1353 >AF100670-2|AAN73857.3| 554|Caenorhabditis elegans Hypothetical protein M4.1 protein. Length = 554 Score = 28.3 bits (60), Expect = 5.9 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +1 Query: 10 ACRSAAKPIVNEDA*LGNVSSLEGRIFVLYDN 105 A +A K +VNED L + SLE ++ +L N Sbjct: 201 AAETAWKALVNEDRLLARIESLEAQLSILSSN 232 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,521,339 Number of Sequences: 27780 Number of extensions: 348957 Number of successful extensions: 787 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 774 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 787 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1718929214 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -