BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30384 (548 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 23 2.3 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 23 2.3 EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B pro... 22 3.1 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 7.1 EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopre... 21 9.4 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 22.6 bits (46), Expect = 2.3 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +3 Query: 411 GTDPEDVIKNAFGCFDEENNG 473 G DPE ++ N G F + N G Sbjct: 306 GQDPESLLINGKGQFRDPNTG 326 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 22.6 bits (46), Expect = 2.3 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +3 Query: 411 GTDPEDVIKNAFGCFDEENNG 473 G DPE ++ N G F + N G Sbjct: 306 GQDPESLLINGKGQFRDPNTG 326 >EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B protein. Length = 279 Score = 22.2 bits (45), Expect = 3.1 Identities = 9/25 (36%), Positives = 11/25 (44%) Frame = +2 Query: 473 CDW*GATPRAATTMGDRFTDDDVDE 547 CDW P A R TD+ + E Sbjct: 222 CDWVRNVPECADWYKGRLTDEQLKE 246 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 7.1 Identities = 7/36 (19%), Positives = 17/36 (47%) Frame = -1 Query: 323 GWVFA*RCKHIMQIVLVNESIPVLINHIESLLELCY 216 GW+ + ++V +P L +++ + +CY Sbjct: 1980 GWLLSAAVSPSRRVVDAGYDVPTLSKYLDWIAVMCY 2015 >EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopressin-like peptide protein. Length = 146 Score = 20.6 bits (41), Expect = 9.4 Identities = 6/15 (40%), Positives = 8/15 (53%) Frame = -3 Query: 318 GFCLKMQAYHADRPC 274 G C + HAD+ C Sbjct: 108 GICCSQDSCHADKSC 122 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 127,642 Number of Sequences: 336 Number of extensions: 2742 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13516233 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -