BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30383 (627 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z98877-14|CAD56615.1| 338|Caenorhabditis elegans Hypothetical p... 28 6.3 Z82078-9|CAE11308.1| 949|Caenorhabditis elegans Hypothetical pr... 27 8.3 Z82078-8|CAB04948.2| 947|Caenorhabditis elegans Hypothetical pr... 27 8.3 Z70208-7|CAA94139.1| 287|Caenorhabditis elegans Hypothetical pr... 27 8.3 AL110487-1|CAB54424.1| 610|Caenorhabditis elegans Hypothetical ... 27 8.3 AL023844-13|CAE11312.1| 949|Caenorhabditis elegans Hypothetical... 27 8.3 AL023844-12|CAA19535.2| 947|Caenorhabditis elegans Hypothetical... 27 8.3 >Z98877-14|CAD56615.1| 338|Caenorhabditis elegans Hypothetical protein Y69H2.14 protein. Length = 338 Score = 27.9 bits (59), Expect = 6.3 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 6/38 (15%) Frame = -3 Query: 385 DNCKPQSPARRSFSGLPGPLGQ----GE--HADSFSVA 290 ++C+ +PAR+ G PGP GQ GE H+D+ S A Sbjct: 190 NDCQTCAPARQGAPGPPGPAGQPGQPGEPGHSDTSSTA 227 >Z82078-9|CAE11308.1| 949|Caenorhabditis elegans Hypothetical protein Y48A6B.11b protein. Length = 949 Score = 27.5 bits (58), Expect = 8.3 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = -1 Query: 597 ETLVTTFTSSK*SSLVNFPTTPTAVKPPRVGPKTSLNHSIGS 472 + VT TS K + TP + KPPR P+T L+ S Sbjct: 112 DEFVTPSTSKKSQKPRSSDATPVSSKPPRYLPRTPLSEQYTS 153 >Z82078-8|CAB04948.2| 947|Caenorhabditis elegans Hypothetical protein Y48A6B.11a protein. Length = 947 Score = 27.5 bits (58), Expect = 8.3 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = -1 Query: 597 ETLVTTFTSSK*SSLVNFPTTPTAVKPPRVGPKTSLNHSIGS 472 + VT TS K + TP + KPPR P+T L+ S Sbjct: 110 DEFVTPSTSKKSQKPRSSDATPVSSKPPRYLPRTPLSEQYTS 151 >Z70208-7|CAA94139.1| 287|Caenorhabditis elegans Hypothetical protein F54B11.7 protein. Length = 287 Score = 27.5 bits (58), Expect = 8.3 Identities = 16/27 (59%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = -1 Query: 543 PTTPTAVKPPRVGPKTSLNHS-IGSSD 466 PTTP A KP PKTSL+ S GS+D Sbjct: 69 PTTPPA-KPKEPAPKTSLSKSDSGSAD 94 >AL110487-1|CAB54424.1| 610|Caenorhabditis elegans Hypothetical protein Y39E4B.1 protein. Length = 610 Score = 27.5 bits (58), Expect = 8.3 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -1 Query: 411 LLGIPRLWGIIANPNPQHEGVSAGCPGL*ARENM 310 L G+P ++G++ P+ EG++ G ENM Sbjct: 300 LYGVPGVYGVVTLPSGVREGINMFLEGFIRTENM 333 >AL023844-13|CAE11312.1| 949|Caenorhabditis elegans Hypothetical protein Y48A6B.11b protein. Length = 949 Score = 27.5 bits (58), Expect = 8.3 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = -1 Query: 597 ETLVTTFTSSK*SSLVNFPTTPTAVKPPRVGPKTSLNHSIGS 472 + VT TS K + TP + KPPR P+T L+ S Sbjct: 112 DEFVTPSTSKKSQKPRSSDATPVSSKPPRYLPRTPLSEQYTS 153 >AL023844-12|CAA19535.2| 947|Caenorhabditis elegans Hypothetical protein Y48A6B.11a protein. Length = 947 Score = 27.5 bits (58), Expect = 8.3 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = -1 Query: 597 ETLVTTFTSSK*SSLVNFPTTPTAVKPPRVGPKTSLNHSIGS 472 + VT TS K + TP + KPPR P+T L+ S Sbjct: 110 DEFVTPSTSKKSQKPRSSDATPVSSKPPRYLPRTPLSEQYTS 151 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,490,448 Number of Sequences: 27780 Number of extensions: 303967 Number of successful extensions: 882 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 761 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 880 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1374536540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -