BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30382 (746 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U02588-1|AAA18901.1| 110|Anopheles gambiae translation initiati... 27 0.81 AJ250916-1|CAB91840.1| 435|Anopheles gambiae serine protease pr... 25 2.5 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 24 4.3 AY578795-1|AAT07300.1| 441|Anopheles gambiae Gbb-60A2 protein. 24 5.7 DQ370036-1|ABD18597.1| 103|Anopheles gambiae putative TIL domai... 23 7.6 >U02588-1|AAA18901.1| 110|Anopheles gambiae translation initiation factor protein. Length = 110 Score = 26.6 bits (56), Expect = 0.81 Identities = 18/63 (28%), Positives = 28/63 (44%), Gaps = 1/63 (1%) Frame = +1 Query: 127 EQKVGVNRLYIFLGLVAFTGLY-LVFGFGAELICNSIGFVYPAYMSMKALESPQKDDDTK 303 +Q+ G L GL A L +V E CN +P Y + L+ Q+++ + Sbjct: 33 QQRNGRKTLTTVQGLSAEYDLKKIVRACKKEFACNGTVIEHPEYGEVLQLQGDQRENICQ 92 Query: 304 WLT 312 WLT Sbjct: 93 WLT 95 >AJ250916-1|CAB91840.1| 435|Anopheles gambiae serine protease protein. Length = 435 Score = 25.0 bits (52), Expect = 2.5 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = +2 Query: 221 YATRSASCTPRTCL*RLWSHRRRMTIQNGLHIGWCTP 331 + TR SC +WS + + I G+ +G C P Sbjct: 111 HCTRYQSCKGPELKDNVWSVLQHLCIVEGISVGICCP 147 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 24.2 bits (50), Expect = 4.3 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = -2 Query: 460 SRSRGTRCIQSAGSTRSRRCTLTASTMETSRR*NRKSTPR*KNR 329 SRSR QSAGS +S + + S + SR +R+S R ++R Sbjct: 1128 SRSRSRSRSQSAGSRKSGSRSRSRSGSQASRG-SRRSRSRSRSR 1170 >AY578795-1|AAT07300.1| 441|Anopheles gambiae Gbb-60A2 protein. Length = 441 Score = 23.8 bits (49), Expect = 5.7 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +1 Query: 151 LYIFLGLVAFTGLYL 195 LY+ +GLV+ TG Y+ Sbjct: 14 LYVLIGLVSSTGFYI 28 >DQ370036-1|ABD18597.1| 103|Anopheles gambiae putative TIL domain protein protein. Length = 103 Score = 23.4 bits (48), Expect = 7.6 Identities = 8/28 (28%), Positives = 13/28 (46%) Frame = -2 Query: 115 NISSMACFCRSDFVLCCLYTLVIWMPLC 32 N+ CFC+ ++V + IW C Sbjct: 66 NVCVAGCFCKKNYVRRAIGGSCIWAKKC 93 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 816,233 Number of Sequences: 2352 Number of extensions: 17726 Number of successful extensions: 255 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 254 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 255 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76923555 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -