BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30378 (702 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q9GPH3 Cluster: Activating transcription factor; n=1; B... 56 1e-06 UniRef50_UPI0000DB747D Cluster: PREDICTED: similar to CG8669-PA,... 47 5e-04 UniRef50_Q1ZXL5 Cluster: Putative uncharacterized protein; n=2; ... 35 2.2 UniRef50_UPI0000D9D19D Cluster: PREDICTED: tubulin tyrosine liga... 33 5.1 UniRef50_Q14679 Cluster: Tubulin--tyrosine ligase-like protein 4... 33 5.1 UniRef50_P36132 Cluster: Putative glycoprotein endopeptidase KAE... 33 5.1 UniRef50_UPI00015B4E9A Cluster: PREDICTED: similar to activating... 33 6.8 UniRef50_Q98LL2 Cluster: Mlr0980 protein; n=2; Rhizobiales|Rep: ... 33 6.8 UniRef50_Q57Y62 Cluster: Putative uncharacterized protein; n=1; ... 33 9.0 UniRef50_P74745 Cluster: Serine/threonine-protein kinase C; n=1;... 33 9.0 UniRef50_Q9ULL0 Cluster: Uncharacterized protein KIAA1210; n=5; ... 33 9.0 >UniRef50_Q9GPH3 Cluster: Activating transcription factor; n=1; Bombyx mori|Rep: Activating transcription factor - Bombyx mori (Silk moth) Length = 236 Score = 55.6 bits (128), Expect = 1e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +3 Query: 579 AVLASSPFVTSQPTEELLREFETVYG 656 AVLASSPFVTSQPTEELLREFETVYG Sbjct: 18 AVLASSPFVTSQPTEELLREFETVYG 43 Score = 39.5 bits (88), Expect = 0.078 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +1 Query: 655 GAVELTHLTPPQSPPG 702 GAVELTHLTPPQSPPG Sbjct: 43 GAVELTHLTPPQSPPG 58 >UniRef50_UPI0000DB747D Cluster: PREDICTED: similar to CG8669-PA, isoform A; n=1; Apis mellifera|Rep: PREDICTED: similar to CG8669-PA, isoform A - Apis mellifera Length = 357 Score = 46.8 bits (106), Expect = 5e-04 Identities = 29/71 (40%), Positives = 40/71 (56%) Frame = +3 Query: 444 LLQQLDSQCKQENIFSNWLEEKVDLPSIFENISEVPERVDPQPPAAVLASSPFVTSQPTE 623 LL++LD K+E FS+WLEEK++LP IFE + P + +P T+ Sbjct: 64 LLEKLDEWIKEEP-FSDWLEEKIELP-IFEELPITENGQIKTTPYNEITKAP--QQDDTQ 119 Query: 624 ELLREFETVYG 656 LL+EFETV G Sbjct: 120 TLLQEFETVLG 130 >UniRef50_Q1ZXL5 Cluster: Putative uncharacterized protein; n=2; Dictyostelium discoideum|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 392 Score = 34.7 bits (76), Expect = 2.2 Identities = 21/60 (35%), Positives = 30/60 (50%) Frame = +3 Query: 444 LLQQLDSQCKQENIFSNWLEEKVDLPSIFENISEVPERVDPQPPAAVLASSPFVTSQPTE 623 L QQL+ Q +EN EE +L I I ++P + PQP V+ + P T QP + Sbjct: 242 LQQQLERQQNEEN-----QEEFDELVPILNEIPDIPVQTQPQPSIPVVKTKPPQTEQPPQ 296 >UniRef50_UPI0000D9D19D Cluster: PREDICTED: tubulin tyrosine ligase-like family, member 4 isoform 2; n=2; Catarrhini|Rep: PREDICTED: tubulin tyrosine ligase-like family, member 4 isoform 2 - Macaca mulatta Length = 970 Score = 33.5 bits (73), Expect = 5.1 Identities = 15/44 (34%), Positives = 27/44 (61%) Frame = +3 Query: 219 TMSASQKESWAAAIDLLTNDECRLLLEVEDFFNDDCDLLKNFPS 350 T ++ +A+ +D+LT D+ R+L+E+ED F+ + FPS Sbjct: 757 TQKIPDQDFYASVLDVLTPDDVRILVEMEDEFSRRGQFERIFPS 800 >UniRef50_Q14679 Cluster: Tubulin--tyrosine ligase-like protein 4; n=26; Eumetazoa|Rep: Tubulin--tyrosine ligase-like protein 4 - Homo sapiens (Human) Length = 1199 Score = 33.5 bits (73), Expect = 5.1 Identities = 15/44 (34%), Positives = 27/44 (61%) Frame = +3 Query: 219 TMSASQKESWAAAIDLLTNDECRLLLEVEDFFNDDCDLLKNFPS 350 T ++ +A+ +D+LT D+ R+L+E+ED F+ + FPS Sbjct: 986 TQKIPDQDFYASVLDVLTPDDVRILVEMEDEFSRRGQFERIFPS 1029 >UniRef50_P36132 Cluster: Putative glycoprotein endopeptidase KAE1; n=17; Eukaryota|Rep: Putative glycoprotein endopeptidase KAE1 - Saccharomyces cerevisiae (Baker's yeast) Length = 386 Score = 33.5 bits (73), Expect = 5.1 Identities = 15/34 (44%), Positives = 23/34 (67%) Frame = +2 Query: 89 HNIKMLAKMAPSQDKLVHLHKTPTSLDINPSGLL 190 +NI+ LAK AP ++ LV L T +D++ SG+L Sbjct: 210 YNIEQLAKKAPHKENLVELPYTVKGMDLSMSGIL 243 >UniRef50_UPI00015B4E9A Cluster: PREDICTED: similar to activating transcription factor; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to activating transcription factor - Nasonia vitripennis Length = 434 Score = 33.1 bits (72), Expect = 6.8 Identities = 16/29 (55%), Positives = 23/29 (79%) Frame = +3 Query: 453 QLDSQCKQENIFSNWLEEKVDLPSIFENI 539 +L S K+E+ F++WLEEK+DLP IFE + Sbjct: 69 ELKSWIKEES-FADWLEEKIDLP-IFEEL 95 >UniRef50_Q98LL2 Cluster: Mlr0980 protein; n=2; Rhizobiales|Rep: Mlr0980 protein - Rhizobium loti (Mesorhizobium loti) Length = 145 Score = 33.1 bits (72), Expect = 6.8 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +3 Query: 561 DPQPPAAVLASSPFVTSQPTEELLREFETVYG 656 DP PP +VL SSP V+ P ++L ++T+ G Sbjct: 65 DPTPPVSVLMSSPIVSCGPQDDLHSVWQTMAG 96 >UniRef50_Q57Y62 Cluster: Putative uncharacterized protein; n=1; Trypanosoma brucei|Rep: Putative uncharacterized protein - Trypanosoma brucei Length = 3030 Score = 32.7 bits (71), Expect = 9.0 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +1 Query: 34 DHDGFLVSNRLHTSVCLHAQ-YKNACQNGALTGQVSPSSQNTNI 162 DH+ S R S+CLHA+ K A + A+ Q PSS N + Sbjct: 1743 DHECDAYSGRGRFSICLHAEGIKPASSSNAVAAQEKPSSSNLGV 1786 >UniRef50_P74745 Cluster: Serine/threonine-protein kinase C; n=1; Synechocystis sp. PCC 6803|Rep: Serine/threonine-protein kinase C - Synechocystis sp. (strain PCC 6803) Length = 535 Score = 32.7 bits (71), Expect = 9.0 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +3 Query: 519 PSIFENISEVPERVDPQP-PAAVLASSPFVTSQPTEELLREFE 644 P++FE S +P P P P + SP TS PTE+ + E Sbjct: 395 PNLFETPSPIPTPATPSPEPTPSPSPSPETTSSPTEDTITPME 437 >UniRef50_Q9ULL0 Cluster: Uncharacterized protein KIAA1210; n=5; Amniota|Rep: Uncharacterized protein KIAA1210 - Homo sapiens (Human) Length = 1093 Score = 32.7 bits (71), Expect = 9.0 Identities = 15/46 (32%), Positives = 28/46 (60%) Frame = +3 Query: 438 NDLLQQLDSQCKQENIFSNWLEEKVDLPSIFENISEVPERVDPQPP 575 ND +QQL S+C + I + ++++V S+ +I + + V+P PP Sbjct: 287 NDFMQQLPSRCPSQPIMNPTVQQQVPTSSVGTSIKQ-SDSVEPIPP 331 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 674,510,201 Number of Sequences: 1657284 Number of extensions: 13053641 Number of successful extensions: 35639 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 34412 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35626 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 55785129165 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -