BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30377 (759 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1703.12 |ubp9||ubiquitin C-terminal hydrolase Ubp9|Schizosac... 26 6.7 SPAC4A8.11c |fas2|lsd1|fatty acid synthase alpha subunit Lsd1 |S... 25 8.9 >SPBC1703.12 |ubp9||ubiquitin C-terminal hydrolase Ubp9|Schizosaccharomyces pombe|chr 2|||Manual Length = 585 Score = 25.8 bits (54), Expect = 6.7 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -2 Query: 659 PLPQPSKPNALLLCGPTRHPITSKNIHQK 573 PLP + PN +C T HP +S + H K Sbjct: 73 PLPS-APPNFKSVCTKTNHPESSSSRHSK 100 >SPAC4A8.11c |fas2|lsd1|fatty acid synthase alpha subunit Lsd1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1842 Score = 25.4 bits (53), Expect = 8.9 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +2 Query: 89 QIISRPPLGVKQSGFPVRRIRRIRSQWSEW 178 +I ++ PL + F R+++R RSQ EW Sbjct: 1388 EIATKTPLPIVDLKFRSRQLQRRRSQIGEW 1417 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,113,905 Number of Sequences: 5004 Number of extensions: 62882 Number of successful extensions: 100 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 100 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 363302114 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -