BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30377 (759 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_04_0063 - 16968412-16968599,16970820-16970994 28 7.0 08_01_0016 - 109152-109214,109296-109385,109853-109954,110046-11... 28 9.3 >03_04_0063 - 16968412-16968599,16970820-16970994 Length = 120 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = -2 Query: 194 LLGVRSILTIENGFSLSYEQENLIASRQEEAC**SDPY 81 LL VR I + NGF SY Q+ +I ++++ SD Y Sbjct: 16 LLHVRLIRKLINGFDQSYNQDTVIYDKEKQIFAWSDLY 53 >08_01_0016 - 109152-109214,109296-109385,109853-109954,110046-110213, 110510-110530,110836-110896,110987-111099,112125-112202, 112294-112434,112532-112696,112776-112868,113096-113162, 113285-113388,113896-114041,114303-114579 Length = 562 Score = 27.9 bits (59), Expect = 9.3 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 4/55 (7%) Frame = -1 Query: 243 SLPKLTRMVI**AVPYPIGSAVHSDH*ERILLILR----TGKPDCFTPRGGLLMI 91 SL +L ++++ VPYP+ A DH + +L +R +G+P T G L++ Sbjct: 127 SLAELEQLLLHQQVPYPVYFAFQDDHFDNLLADIRKIASSGQPASATTGGYKLVV 181 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,512,208 Number of Sequences: 37544 Number of extensions: 420213 Number of successful extensions: 782 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 762 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 782 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2027850416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -