BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30377 (759 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CY... 27 0.48 AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. 24 5.9 >AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CYP6P2 protein. Length = 507 Score = 27.5 bits (58), Expect = 0.48 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -2 Query: 287 LSRSAVTVLLLPLFFHCRNSHEW*YNRQFPTL 192 L+ S + L L+ RN + + NRQFPTL Sbjct: 6 LTLSLLVALATGLYLFVRNRYNYWSNRQFPTL 37 >AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. Length = 437 Score = 23.8 bits (49), Expect = 5.9 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +2 Query: 164 QWSEWTALPIG*GTAYYITIRVSF 235 QW EW P G G AYY + +F Sbjct: 349 QWHEWIIAPEGYG-AYYCSGECNF 371 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 811,035 Number of Sequences: 2352 Number of extensions: 16561 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78586767 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -