BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30372 (341 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC9E9.12c |ybt1|abc1|ABC transporter Ybt1|Schizosaccharomyces ... 27 1.1 SPBC21D10.06c |map4||cell agglutination protein Map4|Schizosacch... 26 1.4 SPBC11B10.05c |rsp1||random septum position protein Rsp1|Schizos... 26 1.8 SPBC2D10.14c |myo51||myosin type V|Schizosaccharomyces pombe|chr... 25 3.2 SPCC285.16c |msh6||MutS protein homolog|Schizosaccharomyces pomb... 24 5.6 SPBC8D2.07c |sfc9||transcription factor TFIIIC complex subunit S... 24 5.6 SPBC106.11c |plg7||phospholipase A2 |Schizosaccharomyces pombe|c... 24 5.6 SPAC1B3.08 |||COP9 signalosome complex subunit 12 |Schizosacchar... 24 7.5 SPAC24C9.16c |cox8||cytochrome c oxidase subunit VIII|Schizosacc... 24 7.5 SPAC15A10.08 |ain1||alpha-actinin|Schizosaccharomyces pombe|chr ... 23 9.8 >SPAC9E9.12c |ybt1|abc1|ABC transporter Ybt1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1427 Score = 26.6 bits (56), Expect = 1.1 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +1 Query: 106 ENLPFDIHNRYKLTLYFILYAGSGLSAPYL 195 E F+++N Y LTL+ I++ AP++ Sbjct: 472 EKRSFEVNNMYSLTLFDIIFKSGMKIAPFI 501 >SPBC21D10.06c |map4||cell agglutination protein Map4|Schizosaccharomyces pombe|chr 2|||Manual Length = 948 Score = 26.2 bits (55), Expect = 1.4 Identities = 18/55 (32%), Positives = 24/55 (43%) Frame = +2 Query: 155 SSYMRALDYQHPISSPVTSF*RSNSSCRDPLLVLGLS**KTVHYESLWMSKINYM 319 +S L Y PI+SP TS N D + LS + +S S INY+ Sbjct: 178 TSVSSTLTYHTPIASPTTSSNSDNEYTVDVITSSSLSSFVITNVDSTTTSVINYI 232 >SPBC11B10.05c |rsp1||random septum position protein Rsp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 494 Score = 25.8 bits (54), Expect = 1.8 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +1 Query: 4 KRKEITPLTRISNKLGRNVVTN 69 KR+ TPL+ ISN L N V N Sbjct: 221 KRRTYTPLSEISNGLNSNGVEN 242 >SPBC2D10.14c |myo51||myosin type V|Schizosaccharomyces pombe|chr 2|||Manual Length = 1471 Score = 25.0 bits (52), Expect = 3.2 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 141 LVTVVNVEG*ILARNTAVRMVSHEIRYHISAQFV 40 L+T NV +L R+ V ++ E YHI Q + Sbjct: 233 LITGANVNTYLLERSRVVSLLKGERNYHIFYQLI 266 >SPCC285.16c |msh6||MutS protein homolog|Schizosaccharomyces pombe|chr 3|||Manual Length = 1254 Score = 24.2 bits (50), Expect = 5.6 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +1 Query: 4 KRKEITPLTRISNKLGRN 57 KR ITP+T I +LG N Sbjct: 1053 KRASITPMTSIYTRLGAN 1070 >SPBC8D2.07c |sfc9||transcription factor TFIIIC complex subunit Sfc9 |Schizosaccharomyces pombe|chr 2|||Manual Length = 673 Score = 24.2 bits (50), Expect = 5.6 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +1 Query: 133 RYKLTLYFILYAGSGLS 183 RY+LTLY +LY S +S Sbjct: 525 RYRLTLYIMLYTLSQIS 541 >SPBC106.11c |plg7||phospholipase A2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 438 Score = 24.2 bits (50), Expect = 5.6 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +1 Query: 58 VVTNFVRNHSNGGIPGENLPF 120 + +RN ++ G P ENLPF Sbjct: 204 IALQMIRNINDLGTPDENLPF 224 >SPAC1B3.08 |||COP9 signalosome complex subunit 12 |Schizosaccharomyces pombe|chr 1|||Manual Length = 423 Score = 23.8 bits (49), Expect = 7.5 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -1 Query: 263 LNLKQAKDLCSLNYFFKSW 207 L L+ +DLC N F K+W Sbjct: 337 LTLEGTRDLCIRNLFRKTW 355 >SPAC24C9.16c |cox8||cytochrome c oxidase subunit VIII|Schizosaccharomyces pombe|chr 1|||Manual Length = 66 Score = 23.8 bits (49), Expect = 7.5 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = +1 Query: 100 PGENLPFDIHNRYKLTLYFILYAGSGLSAPYLITRH 207 PG +PF I+ + TL + G S P+++ ++ Sbjct: 26 PGSTIPFYINKKPLPTLLYFGTFGVIFSIPFIVVKY 61 >SPAC15A10.08 |ain1||alpha-actinin|Schizosaccharomyces pombe|chr 1|||Manual Length = 621 Score = 23.4 bits (48), Expect = 9.8 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = -1 Query: 86 EWFLTKFVTTFLPNLFEMR 30 +WF TK + LP++F++R Sbjct: 16 KWFNTKLSSRDLPSVFDLR 34 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,330,173 Number of Sequences: 5004 Number of extensions: 25251 Number of successful extensions: 74 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 74 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 74 length of database: 2,362,478 effective HSP length: 64 effective length of database: 2,042,222 effective search space used: 100068878 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -