BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30372 (341 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0259 + 32712976-32714335,32714454-32714587,32714904-327151... 27 3.9 03_03_0041 - 14007687-14009381 27 3.9 07_01_1006 + 8528508-8529285,8529376-8529544,8530179-8530445,853... 27 5.1 07_01_0766 - 5885207-5885791,5885874-5886224,5886252-5886269,588... 27 5.1 07_03_1010 - 23276442-23276681,23277022-23277267 26 6.7 03_05_0923 + 28848925-28849272,28849636-28849869,28849965-288501... 26 6.7 07_03_0123 - 13688562-13689146,13689233-13689583,13689665-136898... 26 8.9 04_04_0941 - 29544252-29544355,29545155-29545299,29545637-295457... 26 8.9 03_06_0596 + 34964109-34964189,34964286-34964481,34964567-349647... 26 8.9 03_06_0389 - 33567385-33567969,33568052-33568402,33568646-335688... 26 8.9 01_06_1642 + 38857326-38857581,38858577-38858818,38859001-388600... 26 8.9 01_06_0039 + 25857805-25858894,25858997-25859345,25860019-258601... 26 8.9 >03_06_0259 + 32712976-32714335,32714454-32714587,32714904-32715144, 32715254-32715462,32715522-32715583,32715690-32715801, 32715916-32716208,32716400-32716520 Length = 843 Score = 27.1 bits (57), Expect = 3.9 Identities = 15/31 (48%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = +1 Query: 46 LGRNVVTNFV-RNHSNGGIPGENLPFDIHNR 135 LGR VVT + RN GG+PGE F + R Sbjct: 244 LGRKVVTVVLSRNRFTGGLPGEITSFYLLER 274 >03_03_0041 - 14007687-14009381 Length = 564 Score = 27.1 bits (57), Expect = 3.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 135 LQADIVFHPICGLWTISTLSHHPSPA 212 L D++FHP C T+S L P P+ Sbjct: 59 LPGDLLFHPACVRLTLSHLLPSPDPS 84 >07_01_1006 + 8528508-8529285,8529376-8529544,8530179-8530445, 8530533-8530878,8530964-8531101,8531197-8531322, 8531422-8531634,8531721-8531863,8531891-8532009, 8532099-8532295,8532379-8532729,8532811-8533395 Length = 1143 Score = 26.6 bits (56), Expect = 5.1 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -1 Query: 83 WFLTKFVTTFLPNLFEMRVNGV 18 WF++ F+ F+ + EMR +GV Sbjct: 957 WFMSLFICIFVTGILEMRWSGV 978 >07_01_0766 - 5885207-5885791,5885874-5886224,5886252-5886269, 5886339-5886541,5886632-5886890,5887052-5887264, 5887357-5887482,5887590-5887727,5887817-5888162, 5888254-5888520,5888983-5889172,5889264-5889363, 5889444-5889694,5889990-5890182,5890313-5890336 Length = 1087 Score = 26.6 bits (56), Expect = 5.1 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -1 Query: 83 WFLTKFVTTFLPNLFEMRVNGV 18 WF++ F++ F + EMR +GV Sbjct: 901 WFISLFISIFATGILEMRWSGV 922 >07_03_1010 - 23276442-23276681,23277022-23277267 Length = 161 Score = 26.2 bits (55), Expect = 6.7 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +3 Query: 174 WTISTLSHHPSPAFEE 221 W I T+ H PSPA +E Sbjct: 122 WIIKTMKHEPSPAQDE 137 >03_05_0923 + 28848925-28849272,28849636-28849869,28849965-28850131, 28850433-28850651,28850743-28850929,28851012-28851063, 28851158-28851387,28851619-28851717,28851835-28852565, 28853004-28853519,28854140-28854398 Length = 1013 Score = 26.2 bits (55), Expect = 6.7 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +3 Query: 174 WTISTLSHHPSPAFEE 221 W I T+ H PSPA +E Sbjct: 156 WIIKTMKHEPSPAQDE 171 >07_03_0123 - 13688562-13689146,13689233-13689583,13689665-13689861, 13689954-13690072,13690103-13690245,13690332-13690544, 13690649-13690774,13690891-13691028,13691109-13691454, 13691532-13691798,13691939-13691983,13692148-13692349, 13692405-13692507,13692599-13692810,13692891-13693113, 13693211-13693291 Length = 1116 Score = 25.8 bits (54), Expect = 8.9 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 83 WFLTKFVTTFLPNLFEMRVNGV 18 WF++ F+ F + EMR +GV Sbjct: 930 WFMSLFICIFATGILEMRWSGV 951 >04_04_0941 - 29544252-29544355,29545155-29545299,29545637-29545775, 29545836-29545893,29546012-29546123,29546311-29546484, 29547276-29547450,29547531-29547589,29548008-29548109, 29548178-29548212,29549017-29549111,29549638-29549686, 29549754-29549812,29549978-29550051,29550204-29550296, 29550389-29550769 Length = 617 Score = 25.8 bits (54), Expect = 8.9 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 171 LWTISTLSHHPSPA 212 LW I TL HH SPA Sbjct: 473 LWEIDTLRHHYSPA 486 >03_06_0596 + 34964109-34964189,34964286-34964481,34964567-34964775, 34964868-34964970,34965053-34965227,34965617-34965883, 34965966-34966311,34966396-34966533,34966645-34966770, 34966866-34967078,34967171-34967462,34967559-34967755, 34967844-34968194,34968290-34968874 Length = 1092 Score = 25.8 bits (54), Expect = 8.9 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 83 WFLTKFVTTFLPNLFEMRVNGV 18 WF++ F+ F + EMR +GV Sbjct: 906 WFMSLFICIFATGILEMRWSGV 927 >03_06_0389 - 33567385-33567969,33568052-33568402,33568646-33568848, 33569044-33569299,33569459-33569671,33569757-33569882, 33569965-33570102,33570191-33570536,33570630-33570896, 33571192-33571378,33571457-33571556,33571659-33571909, 33572242-33572428,33572562-33572573 Length = 1073 Score = 25.8 bits (54), Expect = 8.9 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -1 Query: 83 WFLTKFVTTFLPNLFEMRVNGV 18 WF++ F++ F + EMR +GV Sbjct: 887 WFISLFLSIFATGILEMRWSGV 908 >01_06_1642 + 38857326-38857581,38858577-38858818,38859001-38860004, 38860170-38860587,38860673-38860789 Length = 678 Score = 25.8 bits (54), Expect = 8.9 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = +1 Query: 37 SNKLGRNVVTNFVRNHSNGGIPGENLPFDIHNRYKL 144 S+KL R++ + NH + G+P D + +Y + Sbjct: 115 SSKLPRSIFYDLRGNHDSFGVPSPGGDHDFYQKYSI 150 >01_06_0039 + 25857805-25858894,25858997-25859345,25860019-25860104, 25860242-25860399,25861489-25861565,25861656-25861722 Length = 608 Score = 25.8 bits (54), Expect = 8.9 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -1 Query: 101 GIPPLEWFLTKFVTTFLPNLFEMRVNGVISL 9 G P L+W +T F + LPN M + +I++ Sbjct: 87 GAPRLDWSITLFSLSTLPNTLVMGIPLLIAM 117 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,313,582 Number of Sequences: 37544 Number of extensions: 157521 Number of successful extensions: 349 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 345 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 349 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 482105440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -