BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30372 (341 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g50260.1 68414.m05635 C2 domain-containing protein low simila... 29 0.81 At1g73090.1 68414.m08451 expressed protein 27 3.3 At5g05170.1 68418.m00550 cellulose synthase, catalytic subunit (... 27 4.3 At2g42030.1 68415.m05198 zinc finger (C3HC4-type RING finger) fa... 26 5.7 At2g43400.1 68415.m05394 electron transfer flavoprotein-ubiquino... 26 7.6 At3g55740.2 68416.m06193 proline transporter 2 (ProT2) identical... 25 10.0 At3g55740.1 68416.m06192 proline transporter 2 (ProT2) identical... 25 10.0 At1g26610.1 68414.m03241 zinc finger (C2H2 type) family protein ... 25 10.0 >At1g50260.1 68414.m05635 C2 domain-containing protein low similarity to CLB1 [Lycopersicon esculentum] GI:2789434; contains Pfam profile PF00168: C2 domain Length = 675 Score = 29.1 bits (62), Expect = 0.81 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -1 Query: 101 GIPPLEWFLTKFVTTFLPNLF 39 GIP L FLTK +T LP LF Sbjct: 344 GIPVLSMFLTKLLTVDLPRLF 364 >At1g73090.1 68414.m08451 expressed protein Length = 306 Score = 27.1 bits (57), Expect = 3.3 Identities = 11/32 (34%), Positives = 21/32 (65%) Frame = +3 Query: 150 VFHPICGLWTISTLSHHPSPAFEEVIQAAEIL 245 ++ +CG +STL++ SP + EV +A E++ Sbjct: 194 IYGRVCGGPVVSTLANAFSPLYFEVTEAMEVM 225 >At5g05170.1 68418.m00550 cellulose synthase, catalytic subunit (Ath-B) nearly identical to gi:2827143, cellulose synthase, catalytic subunit (Ath-B) Length = 1065 Score = 26.6 bits (56), Expect = 4.3 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -1 Query: 83 WFLTKFVTTFLPNLFEMRVNGV 18 WFL+ F++ F + EMR +GV Sbjct: 879 WFLSLFLSIFATGILEMRWSGV 900 >At2g42030.1 68415.m05198 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 425 Score = 26.2 bits (55), Expect = 5.7 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +2 Query: 29 LASQTNWAEMW*RIS*ETILTAVFLARIY 115 LA+Q WA+M+ R+S T+ +A LA Y Sbjct: 313 LATQRRWAQMYGRVSSFTLSSAERLADTY 341 >At2g43400.1 68415.m05394 electron transfer flavoprotein-ubiquinone oxidoreductase family protein contains Pfam profile: PF05187 Electron transfer flavoprotein-ubiquinone oxidoreductase Length = 633 Score = 25.8 bits (54), Expect = 7.6 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -1 Query: 83 WFLTKFVTTFLPNLFEMRVNGVISL 9 WFLTK LP+ F+ + N VISL Sbjct: 179 WFLTKDRAFSLPSPFDNKGNYVISL 203 >At3g55740.2 68416.m06193 proline transporter 2 (ProT2) identical to proline transporter 2 GI:1769903 from [Arabidopsis thaliana] Length = 383 Score = 25.4 bits (53), Expect = 10.0 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 130 NRYKLTLYFILYAGSGLSAPYLITRHQLLKK 222 N + + FI+ AGS L A Y++ R L K Sbjct: 64 NLFMINCGFIILAGSALKAVYVLFRDDSLMK 94 >At3g55740.1 68416.m06192 proline transporter 2 (ProT2) identical to proline transporter 2 GI:1769903 from [Arabidopsis thaliana] Length = 439 Score = 25.4 bits (53), Expect = 10.0 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 130 NRYKLTLYFILYAGSGLSAPYLITRHQLLKK 222 N + + FI+ AGS L A Y++ R L K Sbjct: 120 NLFMINCGFIILAGSALKAVYVLFRDDSLMK 150 >At1g26610.1 68414.m03241 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 455 Score = 25.4 bits (53), Expect = 10.0 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -2 Query: 85 NGFSRNSLPHFCPICLRCESMG*SL 11 NG + S H CPIC R G +L Sbjct: 390 NGAKKKSKGHECPICFRVFKSGQAL 414 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,814,363 Number of Sequences: 28952 Number of extensions: 128847 Number of successful extensions: 308 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 305 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 308 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 409426656 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -