BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30370 (713 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 23 3.3 DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 22 5.7 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 22 5.7 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 22.6 bits (46), Expect = 3.3 Identities = 13/58 (22%), Positives = 26/58 (44%) Frame = +2 Query: 266 ASGALAAGTIASPWSTPAGAPDTNGSGGADAKHLDVGDASDDEKDMSAADAEGVWSPD 439 +SG + P +T +G+P + S + H+ A+ D + + + +SPD Sbjct: 24 SSGMTSPAAAPPPATTSSGSPASVASNASAPLHIPAKRAAYDCEGVIRHHGQWNYSPD 81 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 21.8 bits (44), Expect = 5.7 Identities = 13/39 (33%), Positives = 16/39 (41%) Frame = +2 Query: 326 PDTNGSGGADAKHLDVGDASDDEKDMSAADAEGVWSPDI 442 PD NG GGA + D A + A G+ DI Sbjct: 369 PDENGEGGAWVGYEDPDTAGNKASYARAKGLGGIAIVDI 407 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.8 bits (44), Expect = 5.7 Identities = 14/42 (33%), Positives = 20/42 (47%), Gaps = 5/42 (11%) Frame = -3 Query: 603 CDETCFL---VRVL--PVLSLIYLAINSFLPYILPSSERIIL 493 C CF +R+ +L+ +YL + F Y S ERI L Sbjct: 1111 CSNRCFFPSKIRICWNVLLNCVYLFLCGFCVYEFASDERIKL 1152 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,538 Number of Sequences: 336 Number of extensions: 3173 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18947110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -