BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30370 (713 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC409.15 |||rRNA processing protein Tsr2 |Schizosaccharomyces ... 29 0.50 SPCC63.04 |mok14||alpha-1,3-glucan synthase Mok14|Schizosaccharo... 27 2.7 SPBC17A3.04c |||methionine-tRNA ligase |Schizosaccharomyces pomb... 27 3.5 SPBC2G5.02c |||CK2 family regulatory subunit |Schizosaccharomyce... 26 4.7 SPCC1020.01c |pma2|SPCC1393.01|P-type proton ATPase Pma2 |Schizo... 26 4.7 SPBC17D1.02 |||diphthamide biosynthesis protein |Schizosaccharom... 26 4.7 SPAC13G7.10 |mug152||transcription factor |Schizosaccharomyces p... 26 6.1 SPAC25G10.05c |his1||ATP phosphoribosyltransferase |Schizosaccha... 25 8.1 >SPBC409.15 |||rRNA processing protein Tsr2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 179 Score = 29.5 bits (63), Expect = 0.50 Identities = 16/57 (28%), Positives = 27/57 (47%) Frame = +2 Query: 368 DVGDASDDEKDMSAADAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNE 538 +VG DD + A D VW E +++ I+ G ++++ +EGK R E Sbjct: 78 NVGSIEDDSPYILAQDLVNVWKAACEDNYEPIREIHERLG-KQLLEKEEGKEKTREE 133 >SPCC63.04 |mok14||alpha-1,3-glucan synthase Mok14|Schizosaccharomyces pombe|chr 3|||Manual Length = 1369 Score = 27.1 bits (57), Expect = 2.7 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = +1 Query: 130 LHGVIVFCVLWTVIIQNFIQD--VSDKWNYF 216 LH +V C L +VI QNF +S W +F Sbjct: 1152 LHRKVVICFLISVINQNFWMSTLISQAWRFF 1182 >SPBC17A3.04c |||methionine-tRNA ligase |Schizosaccharomyces pombe|chr 2|||Manual Length = 782 Score = 26.6 bits (56), Expect = 3.5 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = -3 Query: 564 LSLIYLAINSFLPYILPSSERIILRRPQGGYIASASWKLCSMSG 433 L+LIYL F PY+ +S I + +W+LC + G Sbjct: 708 LNLIYLLAAIFYPYMPSTSTSIYKQLNAPAAAIPDTWELCLLPG 751 >SPBC2G5.02c |||CK2 family regulatory subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 254 Score = 26.2 bits (55), Expect = 4.7 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = -3 Query: 210 IPFVTYVLDKILNNNSP*HTENYHTV*ISISNTVNLFIIHSR 85 +PF LD IL+ +P EN+ I S + +IH R Sbjct: 75 VPFYNEALDLILDRTAPDTLENFDMDVIETSAQILYGLIHQR 116 >SPCC1020.01c |pma2|SPCC1393.01|P-type proton ATPase Pma2 |Schizosaccharomyces pombe|chr 3|||Manual Length = 1010 Score = 26.2 bits (55), Expect = 4.7 Identities = 21/84 (25%), Positives = 39/84 (46%), Gaps = 5/84 (5%) Frame = +2 Query: 374 GDASDDEKDMSAADA--EGVWSPDIEQSFQEALAIYPPCGRRKII---LSDEGKMYGRNE 538 G+ SD+E + DA E ++S D E+ E P G K++ L + YG E Sbjct: 117 GEGSDNEDEDEDIDALIEDLYSQDQEEEQVEEEESPGPAGAAKVVPEELLETDPKYGLTE 176 Query: 539 LIARYIKLRTGKTRTRKQVSSHIQ 610 K + G + +++ +++I+ Sbjct: 177 SEVEERKKKYGLNQMKEEKTNNIK 200 >SPBC17D1.02 |||diphthamide biosynthesis protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 503 Score = 26.2 bits (55), Expect = 4.7 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +2 Query: 350 ADAKHLDVGDASDDEKDMSAADAEGVWSP 436 ADAK+ D AS +++ M + GV+SP Sbjct: 424 ADAKNNDSSSASIEKRGMRSLAVNGVYSP 452 >SPAC13G7.10 |mug152||transcription factor |Schizosaccharomyces pombe|chr 1|||Manual Length = 390 Score = 25.8 bits (54), Expect = 6.1 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +3 Query: 588 NKSRHTYRC*LGENYEKFKPNLKCNFG 668 N + +R L E+Y+KF PN K + G Sbjct: 95 NDLKDRFRTILPEDYKKFYPNAKTHMG 121 >SPAC25G10.05c |his1||ATP phosphoribosyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 310 Score = 25.4 bits (53), Expect = 8.1 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = -2 Query: 565 P*FNIPRY*LVPSVHLALVGENNFASSTGRVYRQRLLEALFDV 437 P +IPR+ VHL + G++ A + R+ + +E L D+ Sbjct: 58 PAADIPRFVGTGRVHLGITGQDQIAEARLRIGDKLKIEELVDL 100 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,688,190 Number of Sequences: 5004 Number of extensions: 50355 Number of successful extensions: 142 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 139 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 142 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 333194204 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -