BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30368 (743 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 pro... 27 0.12 AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 prot... 25 0.64 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 2.6 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 23 2.6 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 22 4.5 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 4.5 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 4.5 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 4.5 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 4.5 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 22 6.0 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 22 6.0 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 6.0 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 6.0 >DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 protein. Length = 366 Score = 27.5 bits (58), Expect = 0.12 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 649 YRSGEGEFTPHPVFAN-CSRVAY 584 YR+GEG F P + AN C+ V Y Sbjct: 36 YRNGEGSFKPQNINANLCTHVHY 58 >AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 protein. Length = 377 Score = 25.0 bits (52), Expect = 0.64 Identities = 11/22 (50%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = -2 Query: 646 RSGEGEFTPHPVFAN-CSRVAY 584 R G G+FTP + AN C+ V Y Sbjct: 34 RPGNGKFTPEDIDANLCTHVNY 55 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.0 bits (47), Expect = 2.6 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +1 Query: 544 WLKAHYMEAERLRGRPLGSSWQIPGEA*IPPP 639 W K+ E ++ +P SSWQ P + PP Sbjct: 1146 WPKSAKCEEKKPGHKPSTSSWQKPTKPSYRPP 1177 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +1 Query: 259 GQREATPPRDAPLPSFGFTQEQ 324 GQ+E PP D PS +E+ Sbjct: 1770 GQQETIPPIDEEPPSVEAVEEE 1791 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 23.0 bits (47), Expect = 2.6 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 280 GGWPPAAPTRGPPACP 233 G PP P+ GPP+ P Sbjct: 112 GNVPPLTPSPGPPSHP 127 Score = 22.6 bits (46), Expect = 3.4 Identities = 20/82 (24%), Positives = 31/82 (37%), Gaps = 2/82 (2%) Frame = +3 Query: 240 AGGPRVGAAGGHPP*RRSPAEFWLYTGAGRLRLRGPSAGRQHRPAGEVPL-VAAGMRASS 416 + GP GG +R + WL + +G + PS G P + ++ M + S Sbjct: 84 SSGPFSSIGGGISASKRQRTDDWLSSPSGNVPPLTPSPGPPSHPYTVISNGYSSPMSSGS 143 Query: 417 RPRVGAEGE-GHGRLPPGELQG 479 G+ G L P L G Sbjct: 144 YDPYSPNGKIGREDLSPSSLNG 165 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 22.2 bits (45), Expect = 4.5 Identities = 8/27 (29%), Positives = 14/27 (51%) Frame = -1 Query: 524 WLCALKLCDSSSLYSSLKFPRWKATMA 444 W L + + + + FPRW+ T+A Sbjct: 635 WSDMLSVGNMTLILDKFFFPRWRQTLA 661 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.5 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +1 Query: 376 GRFLWSLPACERLHAHESVLKAKAMVAFHRGNFKEL 483 GR +W+LP ++ AH LK K + HR + ++ Sbjct: 670 GRLVWTLPGKTKMIAH---LKDKMKIR-HRKRWSQV 701 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.5 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +1 Query: 376 GRFLWSLPACERLHAHESVLKAKAMVAFHRGNFKEL 483 GR +W+LP ++ AH LK K + HR + ++ Sbjct: 670 GRLVWTLPGKTKMIAH---LKDKMKIR-HRKRWSQV 701 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.5 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +1 Query: 376 GRFLWSLPACERLHAHESVLKAKAMVAFHRGNFKEL 483 GR +W+LP ++ AH LK K + HR + ++ Sbjct: 670 GRLVWTLPGKTKMIAH---LKDKMKIR-HRKRWSQV 701 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.5 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +1 Query: 376 GRFLWSLPACERLHAHESVLKAKAMVAFHRGNFKEL 483 GR +W+LP ++ AH LK K + HR + ++ Sbjct: 670 GRLVWTLPGKTKMIAH---LKDKMKIR-HRKRWSQV 701 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 21.8 bits (44), Expect = 6.0 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +1 Query: 376 GRFLWSLPACERLHAH 423 GR +W+LP ++ AH Sbjct: 95 GRLVWTLPGKTKMIAH 110 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.8 bits (44), Expect = 6.0 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +1 Query: 376 GRFLWSLPACERLHAH 423 GR +W+LP ++ AH Sbjct: 409 GRLVWTLPGKTKMIAH 424 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.8 bits (44), Expect = 6.0 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +1 Query: 376 GRFLWSLPACERLHAH 423 GR +W+LP ++ AH Sbjct: 642 GRLVWTLPGKTKMIAH 657 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.8 bits (44), Expect = 6.0 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +1 Query: 376 GRFLWSLPACERLHAH 423 GR +W+LP ++ AH Sbjct: 642 GRLVWTLPGKTKMIAH 657 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,762 Number of Sequences: 336 Number of extensions: 4192 Number of successful extensions: 21 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19819879 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -