BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30365 (731 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0565 - 19561078-19561425,19562253-19563746 33 0.23 03_02_0018 - 5016752-5017288 28 8.8 >07_03_0565 - 19561078-19561425,19562253-19563746 Length = 613 Score = 33.1 bits (72), Expect = 0.23 Identities = 28/85 (32%), Positives = 40/85 (47%), Gaps = 5/85 (5%) Frame = +1 Query: 121 VDF*GEGVVLTALE--LPQ*HYHRFQQYIQTFADAEHLVIDPTQLFRDCHTFYFF---YD 285 VDF E V+ L P Y +++ + AD D ++ R H+F FF D Sbjct: 175 VDFHFESSVVPLLSRAAPSDTYRIWKRGAELRADTTLAGFDGLRIRRADHSFLFFGEEAD 234 Query: 286 ASAVYLPLGSRLVLNHHKRVHHRSY 360 A +LP GS LVL+ KR H ++ Sbjct: 235 AGGRHLPPGSLLVLHRGKREVHDAF 259 >03_02_0018 - 5016752-5017288 Length = 178 Score = 27.9 bits (59), Expect = 8.8 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 516 RGSGVLHNASCSARILICLNLSLASSTCLSR 608 RG G + +A AR+ + L+LSL S C R Sbjct: 120 RGGGAIAHAHARARLSLSLSLSLFSIDCYER 150 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,649,424 Number of Sequences: 37544 Number of extensions: 307127 Number of successful extensions: 811 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 798 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 811 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1921741964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -