BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30364 (323 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT023873-1|AAZ86794.1| 512|Drosophila melanogaster AT21758p pro... 58 2e-09 AE014134-1275|AAF52515.1| 421|Drosophila melanogaster CG5261-PA... 58 2e-09 AE014134-1274|AAF52514.1| 512|Drosophila melanogaster CG5261-PB... 58 2e-09 >BT023873-1|AAZ86794.1| 512|Drosophila melanogaster AT21758p protein. Length = 512 Score = 58.4 bits (135), Expect = 2e-09 Identities = 25/36 (69%), Positives = 33/36 (91%) Frame = +3 Query: 120 GRVYASPMARRLAEIKNIRLGGQGTGLYGSLKSGDL 227 GRVYASPMA+RLAE + +RL G+G+G++GS+KSGDL Sbjct: 223 GRVYASPMAKRLAEAQQLRLQGKGSGVHGSIKSGDL 258 >AE014134-1275|AAF52515.1| 421|Drosophila melanogaster CG5261-PA, isoform A protein. Length = 421 Score = 58.4 bits (135), Expect = 2e-09 Identities = 25/36 (69%), Positives = 33/36 (91%) Frame = +3 Query: 120 GRVYASPMARRLAEIKNIRLGGQGTGLYGSLKSGDL 227 GRVYASPMA+RLAE + +RL G+G+G++GS+KSGDL Sbjct: 132 GRVYASPMAKRLAEAQQLRLQGKGSGVHGSIKSGDL 167 >AE014134-1274|AAF52514.1| 512|Drosophila melanogaster CG5261-PB, isoform B protein. Length = 512 Score = 58.4 bits (135), Expect = 2e-09 Identities = 25/36 (69%), Positives = 33/36 (91%) Frame = +3 Query: 120 GRVYASPMARRLAEIKNIRLGGQGTGLYGSLKSGDL 227 GRVYASPMA+RLAE + +RL G+G+G++GS+KSGDL Sbjct: 223 GRVYASPMAKRLAEAQQLRLQGKGSGVHGSIKSGDL 258 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,999,773 Number of Sequences: 53049 Number of extensions: 84149 Number of successful extensions: 183 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 164 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 183 length of database: 24,988,368 effective HSP length: 74 effective length of database: 21,062,742 effective search space used: 695070486 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -