BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30362 (770 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 25 2.0 AY752901-1|AAV30075.1| 90|Anopheles gambiae peroxidase 7 protein. 24 4.5 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 25.4 bits (53), Expect = 2.0 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +2 Query: 629 SVVCKENLPARDTVLPDRLGLHAKRLKYVEI*F 727 S++C E + AR +LP+ +H RLK + + F Sbjct: 95 SILCNEAIMARSKLLPNSF-VHLARLKALSLEF 126 >AY752901-1|AAV30075.1| 90|Anopheles gambiae peroxidase 7 protein. Length = 90 Score = 24.2 bits (50), Expect = 4.5 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +2 Query: 287 LSVDFN*FKLRPSIVQSYRTASFR 358 L+ D+N F PS++ S+ TA+FR Sbjct: 58 LTNDYNAFT-NPSVINSHTTAAFR 80 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 730,071 Number of Sequences: 2352 Number of extensions: 14003 Number of successful extensions: 22 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80249979 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -