BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30360 (705 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A4M6Y7 Cluster: ABC transporter related precursor; n=1;... 33 6.8 UniRef50_Q3LW32 Cluster: Putative uncharacterized protein; n=1; ... 33 9.0 >UniRef50_A4M6Y7 Cluster: ABC transporter related precursor; n=1; Petrotoga mobilis SJ95|Rep: ABC transporter related precursor - Petrotoga mobilis SJ95 Length = 504 Score = 33.1 bits (72), Expect = 6.8 Identities = 20/58 (34%), Positives = 31/58 (53%) Frame = -2 Query: 263 KTLNEADDVIPTKSTRIEYLLTTRCTILIDRVKFLILKLIYWIKVEAFQMDKPTGMLT 90 K LNE +++ S ++ TT + + K ILKL+Y KV+ D+PT +LT Sbjct: 117 KILNELEEITKKFSLAVDLQATTSNLSVAAQQKVEILKLLY-RKVDTLIFDEPTAVLT 173 >UniRef50_Q3LW32 Cluster: Putative uncharacterized protein; n=1; Bigelowiella natans|Rep: Putative uncharacterized protein - Bigelowiella natans (Pedinomonas minutissima) (Chlorarachnion sp.(strain CCMP 621)) Length = 600 Score = 32.7 bits (71), Expect = 9.0 Identities = 19/61 (31%), Positives = 32/61 (52%) Frame = -3 Query: 655 DLFCRITIQSRAVLRKRKKTYHCLTNIHYNSGKHFPY*CNVILRNPGVNDLYIRNCEEIT 476 D+F + QS+ ++ K+K Y CL HY+ ++F + CN L ++ NC+ T Sbjct: 176 DVFFTLLKQSKTIISKKKLFYGCL---HYSKSRNFLFLCNNNL------EILKFNCQSYT 226 Query: 475 F 473 F Sbjct: 227 F 227 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 700,861,409 Number of Sequences: 1657284 Number of extensions: 15090013 Number of successful extensions: 38805 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 37116 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38771 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 56198352344 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -