BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30355 (759 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 28 0.093 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 23 3.5 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 22 4.6 AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 22 4.6 AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 22 4.6 DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 22 6.1 AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 21 8.1 AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein p... 21 8.1 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 27.9 bits (59), Expect = 0.093 Identities = 15/54 (27%), Positives = 27/54 (50%) Frame = -3 Query: 646 EGHPEHEGILGHPDFGRSVVQEQSDETHRHHQLTHQDRVHLSDESPAYRFFSEI 485 +G P+ + +LG P FGRS + ++ET + R ++P + + EI Sbjct: 406 KGFPKSKIVLGVPFFGRSFTLQFTNETQVGAPIKGPGREGFYTQNPGFLAYFEI 459 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 22.6 bits (46), Expect = 3.5 Identities = 11/33 (33%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = -3 Query: 667 ETDYQHYEGHPEHEGILGHPDFGRS-VVQEQSD 572 + Y G P + +LG P FGR+ + ++SD Sbjct: 279 QVKYWMSNGAPSAKIVLGLPTFGRAWAMDDESD 311 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 22.2 bits (45), Expect = 4.6 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = -3 Query: 136 VKIPLTISRCSNFYTMNFTIDSLDKHNL 53 VKIPL I SN + LDK N+ Sbjct: 447 VKIPLVIIWSSNLSKRPYIYKYLDKKNV 474 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 22.2 bits (45), Expect = 4.6 Identities = 14/66 (21%), Positives = 30/66 (45%), Gaps = 1/66 (1%) Frame = +2 Query: 482 FDFTEKSIRRAFIRKVYAILMCQLMVTMGFIALFLYHRPTK-VWVAQNPFMFWVAFIVLI 658 FD S + + IR I +++ +F++ PTK + ++ + +AF V+ Sbjct: 29 FDINTPSFKLSKIRSFLNITASAVLLPFAIYHIFMHIVPTKLISFYKSTAILEIAFEVIF 88 Query: 659 VCLIAM 676 + + M Sbjct: 89 IVTVWM 94 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 22.2 bits (45), Expect = 4.6 Identities = 13/56 (23%), Positives = 22/56 (39%) Frame = -1 Query: 735 KMARNMKFVGALRLTSGQHAIAMRQTISTMKATQNMKGFWATQTLVGRWYRNRAMK 568 KM + +L+L Q ++ + + TQT V W++NR K Sbjct: 120 KMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSK 175 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 21.8 bits (44), Expect = 6.1 Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 4/33 (12%) Frame = -3 Query: 679 RHRDETDYQ-HY---EGHPEHEGILGHPDFGRS 593 ++ + DYQ Y +G P ++ ILG P +GR+ Sbjct: 263 KYDENVDYQVRYWLQKGAPNNKLILGIPAYGRA 295 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 21.4 bits (43), Expect = 8.1 Identities = 13/44 (29%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +1 Query: 160 LEGPTKLREHVSESRRTVPSGRGV-PARWTVPARWTVPARWTIP 288 L+G ++R+HV + +VP + V P + + VP + T+P Sbjct: 170 LQGDGRMRQHVMHNLSSVPQPQPVLPTYKWMQVKRNVP-KPTVP 212 >AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein protein. Length = 253 Score = 21.4 bits (43), Expect = 8.1 Identities = 13/44 (29%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +1 Query: 160 LEGPTKLREHVSESRRTVPSGRGV-PARWTVPARWTVPARWTIP 288 L+G ++R+HV + +VP + V P + + VP + T+P Sbjct: 170 LQGDGRMRQHVMHNLSSVPQPQPVLPTYKWMQVKRNVP-KPTVP 212 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,738 Number of Sequences: 336 Number of extensions: 3929 Number of successful extensions: 19 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20338724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -