BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30354 (712 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein pro... 26 0.31 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 23 2.2 >L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein protein. Length = 69 Score = 26.2 bits (55), Expect = 0.31 Identities = 15/48 (31%), Positives = 26/48 (54%) Frame = +3 Query: 93 CCNQSDLSRELRLRASKLCQIYRHRDMLKVTYRCRVCHQLCWILQRYS 236 C N+S L+ L+ ++ +Y++R TY + CH L L++YS Sbjct: 26 CVNKSMLNSHLKSHSN----VYQYR-CANCTYATKYCHSLKLHLRKYS 68 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 23.4 bits (48), Expect = 2.2 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -2 Query: 531 LASSAFCSAV*ALLRKLQTLSI 466 LA S F + ALLRK+Q +SI Sbjct: 323 LALSVFALILTALLRKMQEMSI 344 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,187 Number of Sequences: 438 Number of extensions: 4004 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21926700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -