BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30348 (696 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 23 1.8 AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix... 21 9.6 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 23.4 bits (48), Expect = 1.8 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = -1 Query: 237 HSWRNLKATSNVAPPQFSSEYRLLK 163 +SW + A +NV+PP+ + + L+K Sbjct: 59 YSWTEINAFANVSPPK-TKFFNLIK 82 >AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix transcription factor protein. Length = 249 Score = 21.0 bits (42), Expect = 9.6 Identities = 12/42 (28%), Positives = 18/42 (42%) Frame = -3 Query: 322 ADRVRAAEQHLERNVRDQLPHVVETLPRTLVEESQGHVECSS 197 AD + +HL+ R Q T P + + G EC+S Sbjct: 78 ADILEMTVKHLQNLQRQQAAMSAATDPSVVSKFRAGFSECAS 119 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,984 Number of Sequences: 336 Number of extensions: 2241 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18322480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -