BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30346 (741 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 21 7.9 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 21 7.9 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = +3 Query: 288 LGRLYPMICRRSKMSLRNKVTLYKTCIRPV 377 LGR++ CR + S N ++ + C+ V Sbjct: 304 LGRIFRAYCRENHASWVNHLSNIEDCLNYV 333 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 21.4 bits (43), Expect = 7.9 Identities = 11/36 (30%), Positives = 14/36 (38%) Frame = +2 Query: 17 GTVVPEVAHRHQPHEKHSGALQKGSPSEHHAEHPSP 124 G P VAHR H + +HA H +P Sbjct: 24 GLYEPHVAHRPGLQGLHHSPHLNHAMHPYHANHVNP 59 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,090 Number of Sequences: 336 Number of extensions: 4675 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19884055 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -