BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30344 (643 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY280612-1|AAQ21365.1| 309|Anopheles gambiae carbonic anhydrase... 24 4.7 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 23 6.2 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 8.2 >AY280612-1|AAQ21365.1| 309|Anopheles gambiae carbonic anhydrase protein. Length = 309 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -1 Query: 601 HYIAPNDRDVIINRDRGNLGGR 536 H I N+RD I G LGGR Sbjct: 87 HSIQINNRDSAITMQGGGLGGR 108 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.4 bits (48), Expect = 6.2 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = -2 Query: 564 IEIAETLAVGGRRDNQPSPSEHLHSSHTPDPLDIFNKK 451 + + + GG PSP HL S H PL + + K Sbjct: 701 VAVVSSSPTGGHHLASPSPHHHLTSPHGA-PLALTSSK 737 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.0 bits (47), Expect = 8.2 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 410 NKPGIFMVIRRVFSFLLKMS 469 N+ F+V R V SFLLKM+ Sbjct: 1184 NETSKFVVFRPVDSFLLKMT 1203 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 666,658 Number of Sequences: 2352 Number of extensions: 13762 Number of successful extensions: 21 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63141405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -