BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30344 (643 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 30 1.5 At1g32360.1 68414.m03989 zinc finger (CCCH-type) family protein ... 28 4.6 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 29.9 bits (64), Expect = 1.5 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = -2 Query: 540 VGGRRDNQPSPSEHLHSSHTPDPLDIFNKKENTRR 436 VG R +P PS+H H SH P I ++E R Sbjct: 105 VGRRERAKPDPSKHHHRSHLPHSKKIETEEERRLR 139 >At1g32360.1 68414.m03989 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 384 Score = 28.3 bits (60), Expect = 4.6 Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Frame = -1 Query: 643 CP--TNLLYGTSLQECHYIAPNDRDVIINRDRGNLGGRGTP*QSAVSV 506 CP TN + +++E PN ++++ + GG GTP S V + Sbjct: 105 CPYITNCNFAHTVEELRRPPPNWQEIVAAHEEERSGGMGTPTVSVVEI 152 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,519,926 Number of Sequences: 28952 Number of extensions: 267558 Number of successful extensions: 571 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 564 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 571 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1324661040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -