BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30342 (736 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC025716-10|AAK39607.1| 474|Caenorhabditis elegans Hypothetical... 30 1.5 Z92789-7|CAB07215.2| 1319|Caenorhabditis elegans Hypothetical pr... 28 6.0 U51998-5|AAL00856.2| 648|Caenorhabditis elegans Hypothetical pr... 28 6.0 U42835-2|AAA83586.1| 617|Caenorhabditis elegans Chitinase prote... 28 6.0 AF039711-8|ABS19466.1| 766|Caenorhabditis elegans Hypothetical ... 28 7.9 >AC025716-10|AAK39607.1| 474|Caenorhabditis elegans Hypothetical protein Y39G10AR.7 protein. Length = 474 Score = 30.3 bits (65), Expect = 1.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -2 Query: 435 CNSTRKGSCLDRKKYYPDKCMWF 367 CN RKG C+D KK + WF Sbjct: 256 CNIFRKGECIDEKKERQNMIQWF 278 >Z92789-7|CAB07215.2| 1319|Caenorhabditis elegans Hypothetical protein H02I12.1 protein. Length = 1319 Score = 28.3 bits (60), Expect = 6.0 Identities = 21/82 (25%), Positives = 30/82 (36%), Gaps = 2/82 (2%) Frame = +3 Query: 168 LFYNYQCPSTSVFNPNTAMCTDPXXXXXXXXXXXXXXXXED--GYIADPSSTNCSSYIEC 341 LF + C S+ FN T C P + +IAD + NC + C Sbjct: 1207 LFEHPSCQSSLAFNQLTGKCDYPQKVSGCENHGQTNGECSEHGSFIAD--ANNCEVFYRC 1264 Query: 342 VGINGTFTETTYTCPDNTFYDP 407 V + TCP T ++P Sbjct: 1265 V----WGRKVVMTCPSGTVFNP 1282 >U51998-5|AAL00856.2| 648|Caenorhabditis elegans Hypothetical protein C12D12.1b protein. Length = 648 Score = 28.3 bits (60), Expect = 6.0 Identities = 25/92 (27%), Positives = 35/92 (38%), Gaps = 2/92 (2%) Frame = +1 Query: 67 STVRRPEQADLPMTMTRLVKTTRF--ASTILRL*IICSTTINVHRRPCSIRTLQCVPILP 240 ST+ P +P T T + TT A+ T P ++ T P+ P Sbjct: 476 STMSPPTTVTVPTTPTPVPTTTNTPPANPTTATPTTVGTIGTSPTAPANLTTPTTAPVNP 535 Query: 241 TTYAM*RPQILPFVPKTGTSPIRAPQIVPVTS 336 T+ P P TSP AP + PVT+ Sbjct: 536 TSSTT-----APTAPVNPTSPTTAPTVPPVTT 562 >U42835-2|AAA83586.1| 617|Caenorhabditis elegans Chitinase protein 1 protein. Length = 617 Score = 28.3 bits (60), Expect = 6.0 Identities = 18/58 (31%), Positives = 25/58 (43%) Frame = +3 Query: 63 AVNCTQTGAGRFADDDDTTCQNYTLCVYDTSTLDYLFYNYQCPSTSVFNPNTAMCTDP 236 A CT+ G D C + CV S YN++CP+ F+ +T MC P Sbjct: 563 AFKCTKDGFFGVPSD----CLKFIRCVNGIS------YNFECPNGLSFHADTMMCDRP 610 >AF039711-8|ABS19466.1| 766|Caenorhabditis elegans Hypothetical protein F49D11.10 protein. Length = 766 Score = 27.9 bits (59), Expect = 7.9 Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = +3 Query: 6 TKAGIVLILVFCC--VWQVQAAVNCTQTGAGRFA 101 TK G+V C VW++Q AV C G FA Sbjct: 598 TKKGVVCWDTLCLLVVWKIQQAVGCVVNSIGCFA 631 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,409,092 Number of Sequences: 27780 Number of extensions: 358691 Number of successful extensions: 1001 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 936 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1001 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1724918872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -