BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30339 (775 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 26 1.5 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 26 1.5 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 26 1.5 AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-spe... 26 1.5 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 25 2.6 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 25 3.4 AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform ... 25 3.4 AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform ... 25 3.4 AY330180-1|AAQ16286.1| 176|Anopheles gambiae odorant-binding pr... 25 3.4 AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide recepto... 25 3.4 AJ618924-1|CAF02003.1| 144|Anopheles gambiae odorant-binding pr... 25 3.4 AF393486-1|AAL60411.1| 162|Anopheles gambiae twelve cysteine pr... 25 3.4 AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 24 6.0 AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14... 23 7.9 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 25.8 bits (54), Expect = 1.5 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = -3 Query: 446 KVNSLESEEQQERHHKTEQTHSLRQGETQ 360 ++ L+ ++QQ+ HH+ +Q S Q ++Q Sbjct: 240 QLERLQQQQQQQTHHQQQQHPSSHQQQSQ 268 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 25.8 bits (54), Expect = 1.5 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = -3 Query: 446 KVNSLESEEQQERHHKTEQTHSLRQGETQ 360 ++ L+ ++QQ+ HH+ +Q S Q ++Q Sbjct: 240 QLERLQQQQQQQTHHQQQQHPSSHQQQSQ 268 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 25.8 bits (54), Expect = 1.5 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = -3 Query: 446 KVNSLESEEQQERHHKTEQTHSLRQGETQ 360 ++ L+ ++QQ+ HH+ +Q S Q ++Q Sbjct: 192 QLERLQQQQQQQTHHQQQQHPSSHQQQSQ 220 >AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-specific zinc-fingerC isoform protein. Length = 569 Score = 25.8 bits (54), Expect = 1.5 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = -3 Query: 446 KVNSLESEEQQERHHKTEQTHSLRQGETQ 360 ++ L+ ++QQ+ HH+ +Q S Q ++Q Sbjct: 240 QLERLQQQQQQQTHHQQQQHPSSHQQQSQ 268 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 25.0 bits (52), Expect = 2.6 Identities = 9/25 (36%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = -3 Query: 170 RELCRDSRYHLCMGGY-CCKWSHQC 99 ++LC +++ L MGG+ KW+ C Sbjct: 882 KQLCEETKAALAMGGFPLRKWASNC 906 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 24.6 bits (51), Expect = 3.4 Identities = 19/57 (33%), Positives = 26/57 (45%) Frame = -3 Query: 257 SHCRCTSTNEFGSRVNVLSDRCGLEGPHCRELCRDSRYHLCMGGYCCKWSHQCRVAE 87 S+CR T+ R N L RCGL G R +++ LC G + S R A+ Sbjct: 519 SNCRSTA-----DRQN-LCIRCGLTGHKARSCQNEAKCALCGGAHHIGHSECARSAQ 569 >AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform B protein. Length = 755 Score = 24.6 bits (51), Expect = 3.4 Identities = 12/47 (25%), Positives = 24/47 (51%) Frame = -3 Query: 287 CSNTSSGTSYSHCRCTSTNEFGSRVNVLSDRCGLEGPHCRELCRDSR 147 C+ ++ T +SHC+C + G +L+ + GP ++C + R Sbjct: 183 CTPNATNTVWSHCQCVLAD--GVERGILTVNRMIPGPSI-QVCENDR 226 >AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform A protein. Length = 753 Score = 24.6 bits (51), Expect = 3.4 Identities = 12/47 (25%), Positives = 24/47 (51%) Frame = -3 Query: 287 CSNTSSGTSYSHCRCTSTNEFGSRVNVLSDRCGLEGPHCRELCRDSR 147 C+ ++ T +SHC+C + G +L+ + GP ++C + R Sbjct: 183 CTPNATNTVWSHCQCVLAD--GVERGILTVNRMIPGPSI-QVCENDR 226 >AY330180-1|AAQ16286.1| 176|Anopheles gambiae odorant-binding protein AgamOBP54 protein. Length = 176 Score = 24.6 bits (51), Expect = 3.4 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 302 EGAEDCSNTSSGTSYSHCRCTSTNE 228 +GAEDCS++ TS H + T E Sbjct: 51 DGAEDCSSSVDETSEPHDKMMCTLE 75 >AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide receptor protein. Length = 493 Score = 24.6 bits (51), Expect = 3.4 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = -2 Query: 759 IVIEFCNVRALMLNMILIITVYKVRNRNNCSINIMFTYNILLQIFVY 619 IV CN+ A+M+N++ + S N++ T N + F+Y Sbjct: 318 IVFLLCNLPAMMINIVEAFYSLIIEYMVKVS-NLLVTINSSVNFFIY 363 >AJ618924-1|CAF02003.1| 144|Anopheles gambiae odorant-binding protein OBP5470 protein. Length = 144 Score = 24.6 bits (51), Expect = 3.4 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 302 EGAEDCSNTSSGTSYSHCRCTSTNE 228 +GAEDCS++ TS H + T E Sbjct: 14 DGAEDCSSSVDETSEPHDKMMCTLE 38 >AF393486-1|AAL60411.1| 162|Anopheles gambiae twelve cysteine protein 1 protein. Length = 162 Score = 24.6 bits (51), Expect = 3.4 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 302 EGAEDCSNTSSGTSYSHCRCTSTNE 228 +GAEDCS++ TS H + T E Sbjct: 51 DGAEDCSSSVDETSEPHDKMMCTLE 75 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 23.8 bits (49), Expect = 6.0 Identities = 14/39 (35%), Positives = 17/39 (43%) Frame = +1 Query: 79 LPSSATLHWCDHLQQYPPIHRWYLLSLHSSLQCGPSRPH 195 LP SAT W Q+ P H ++ SS Q PH Sbjct: 19 LPYSATTGWYPSNYQHQPPHPQFIGDGESSPQPAMYYPH 57 >AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14D2 protein. Length = 372 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = -3 Query: 101 CRVAEDGRPGCRGDQSG 51 C E G+ CRGD G Sbjct: 304 CAGGEKGKDSCRGDSGG 320 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 834,007 Number of Sequences: 2352 Number of extensions: 17708 Number of successful extensions: 56 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 56 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 56 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80665782 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -