BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30337 (803 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methy... 25 2.1 AJ001042-1|CAA04496.1| 395|Anopheles gambiae putative gram nega... 24 4.8 AF081533-1|AAD29854.1| 395|Anopheles gambiae putative gram nega... 24 4.8 AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 24 4.8 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 23 8.3 AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 23 8.3 >AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methylase protein. Length = 459 Score = 25.4 bits (53), Expect = 2.1 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 391 AIHFKKLKSVKLGIDDYQKFLDDLAKNKKVE 483 A HF+ KS K+ ++ Y K K K+E Sbjct: 101 ATHFEANKSFKITVETYNKHFSQREKVAKIE 131 >AJ001042-1|CAA04496.1| 395|Anopheles gambiae putative gram negative bacteria bindingprotein protein. Length = 395 Score = 24.2 bits (50), Expect = 4.8 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = -1 Query: 671 TKSFLPAIPFPFPVSSKRCLCEPVYLLVSVNRSTAAAAAGDFVT 540 TK+ LP F S+ + P + VS+N A GDF T Sbjct: 256 TKNALPEQEFSKSFSTFGFVWTPDNITVSINGEDLATIGGDFWT 299 >AF081533-1|AAD29854.1| 395|Anopheles gambiae putative gram negative bacteria bindingprotein protein. Length = 395 Score = 24.2 bits (50), Expect = 4.8 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = -1 Query: 671 TKSFLPAIPFPFPVSSKRCLCEPVYLLVSVNRSTAAAAAGDFVT 540 TK+ LP F S+ + P + VS+N A GDF T Sbjct: 256 TKNALPEQEFSKSFSTFGFVWTPDNITVSINGEDLATIGGDFWT 299 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 24.2 bits (50), Expect = 4.8 Identities = 17/63 (26%), Positives = 27/63 (42%) Frame = +1 Query: 514 CGQPGITSHVTKSPAAAAAVDRLTDTSKYTGSHRQRFDETGKGKGIAGRKDLVDGSGYVT 693 C + +H P AA + + S +R TGKG+ + D V+ + Y + Sbjct: 322 CKEASDNAHSRVDPDERAAASEIHQERR---SELKRAITTGKGQLFQQQIDEVNANVYGS 378 Query: 694 GYQ 702 GYQ Sbjct: 379 GYQ 381 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 23.4 bits (48), Expect = 8.3 Identities = 16/52 (30%), Positives = 20/52 (38%) Frame = +1 Query: 571 VDRLTDTSKYTGSHRQRFDETGKGKGIAGRKDLVDGSGYVTGYQHKDTYNKS 726 V L+ S + R G G GIA + G G T K TY+ S Sbjct: 852 VSLLSPASSHYSQRSARSPYGGCGSGIASPPAAIHGGGSRTTTVLKRTYSNS 903 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 23.4 bits (48), Expect = 8.3 Identities = 14/49 (28%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = +3 Query: 288 RSQVRWKSHHALAKRQMDEASQSH-*WKENNNNGHGHSLQKTQIGKTRH 431 R + K HH +KR D Q+H + E NG I + H Sbjct: 839 RRMISEKKHHKRSKRVKDGKQQNHVSFPEFVQNGSAKQFANDYINEVLH 887 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 820,851 Number of Sequences: 2352 Number of extensions: 16734 Number of successful extensions: 30 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 84823812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -