BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30336 (519 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC006762-8|AAP31426.1| 295|Caenorhabditis elegans Hypothetical ... 30 1.1 AC006762-7|AAF60555.1| 375|Caenorhabditis elegans Hypothetical ... 30 1.1 U97016-4|AAN84886.1| 2692|Caenorhabditis elegans Lethal protein ... 29 2.0 U97016-3|AAN84885.1| 2695|Caenorhabditis elegans Lethal protein ... 29 2.0 >AC006762-8|AAP31426.1| 295|Caenorhabditis elegans Hypothetical protein Y42G9A.3b protein. Length = 295 Score = 29.9 bits (64), Expect = 1.1 Identities = 17/43 (39%), Positives = 24/43 (55%) Frame = -1 Query: 285 STVCDLHFLDDLI*KNNRIRTFIGVVHTRSKLISRLLRSPPQV 157 ST+ DLH+L+ L NNR+RT + +L LR+ P V Sbjct: 215 STLGDLHYLETLSLHNNRLRTLPTDILNLRRLQQLSLRNNPLV 257 >AC006762-7|AAF60555.1| 375|Caenorhabditis elegans Hypothetical protein Y42G9A.3a protein. Length = 375 Score = 29.9 bits (64), Expect = 1.1 Identities = 17/43 (39%), Positives = 24/43 (55%) Frame = -1 Query: 285 STVCDLHFLDDLI*KNNRIRTFIGVVHTRSKLISRLLRSPPQV 157 ST+ DLH+L+ L NNR+RT + +L LR+ P V Sbjct: 215 STLGDLHYLETLSLHNNRLRTLPTDILNLRRLQQLSLRNNPLV 257 >U97016-4|AAN84886.1| 2692|Caenorhabditis elegans Lethal protein 363, isoform b protein. Length = 2692 Score = 29.1 bits (62), Expect = 2.0 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +2 Query: 41 PGERSDTDRTHGLMRARHSIKSFGEQRSTLLQCKSS 148 P ++ D DR H + + + +QR L++C+SS Sbjct: 296 PSQKDDLDRWHAVALILNELLRISDQRFELIRCESS 331 >U97016-3|AAN84885.1| 2695|Caenorhabditis elegans Lethal protein 363, isoform a protein. Length = 2695 Score = 29.1 bits (62), Expect = 2.0 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +2 Query: 41 PGERSDTDRTHGLMRARHSIKSFGEQRSTLLQCKSS 148 P ++ D DR H + + + +QR L++C+SS Sbjct: 296 PSQKDDLDRWHAVALILNELLRISDQRFELIRCESS 331 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,990,256 Number of Sequences: 27780 Number of extensions: 272901 Number of successful extensions: 674 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 591 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 674 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1007108110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -