BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30335 (714 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC222.05c |mss1||COX RNA-associated protein|Schizosaccharomyce... 28 1.2 SPBP4H10.14c |||sequence orphan|Schizosaccharomyces pombe|chr 2|... 26 4.7 SPAC17A5.14 |exo2||exonuclease II Exo2 |Schizosaccharomyces pomb... 26 6.1 >SPAC222.05c |mss1||COX RNA-associated protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 496 Score = 28.3 bits (60), Expect = 1.2 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = +1 Query: 376 YRHPVYFCREAVMRFGLKGGAAVVTIPETLELISQGG 486 ++ P F E V+ L GG AVV + TLE I Q G Sbjct: 87 FKKPSSFTGEDVVELQLHGGTAVVDV--TLEAIKQSG 121 >SPBP4H10.14c |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 308 Score = 26.2 bits (55), Expect = 4.7 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -1 Query: 552 AHSPPGVKWSLEPIDIYNVKASPTLR 475 A PP +K P+DI N+ A+ L+ Sbjct: 224 ASQPPSIKTDASPVDIKNMDAAEKLK 249 >SPAC17A5.14 |exo2||exonuclease II Exo2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1328 Score = 25.8 bits (54), Expect = 6.1 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = +2 Query: 590 NSSCFINTRALKKRKTDIKVYKHSEKESDRL-RRPT 694 N +NTRA K RKT++ S+ RL +PT Sbjct: 1202 NPQFVVNTRAGKNRKTNVSANNVSQGTDSRLVTKPT 1237 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,737,682 Number of Sequences: 5004 Number of extensions: 53915 Number of successful extensions: 92 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 91 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 92 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 333194204 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -