BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30335 (714 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51372| Best HMM Match : Pyr_redox (HMM E-Value=3e-12) 29 2.8 SB_27517| Best HMM Match : TolA (HMM E-Value=0.25) 28 8.6 >SB_51372| Best HMM Match : Pyr_redox (HMM E-Value=3e-12) Length = 872 Score = 29.5 bits (63), Expect = 2.8 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -3 Query: 466 LRSQV*LQRLPHPSNRNALLLHGRNRQ 386 LR Q +QR P P+ RN++ LHG Q Sbjct: 24 LRQQNQVQRRPEPTPRNSIFLHGLRAQ 50 >SB_27517| Best HMM Match : TolA (HMM E-Value=0.25) Length = 492 Score = 27.9 bits (59), Expect = 8.6 Identities = 12/35 (34%), Positives = 25/35 (71%) Frame = +2 Query: 566 QAIKKSHNNSSCFINTRALKKRKTDIKVYKHSEKE 670 Q I +S N+++ ++T+ KK+KT+++ KH +K+ Sbjct: 45 QTISESTNSNT--LHTKKRKKKKTELQKLKHEKKK 77 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,545,922 Number of Sequences: 59808 Number of extensions: 405858 Number of successful extensions: 719 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 684 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 719 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1889780269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -