BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30334 (773 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_03_0115 + 15422523-15422525,15423103-15423609 29 4.1 04_01_0563 - 7216923-7217300,7217401-7217544,7217680-7218729 29 5.4 >02_03_0115 + 15422523-15422525,15423103-15423609 Length = 169 Score = 29.1 bits (62), Expect = 4.1 Identities = 18/62 (29%), Positives = 33/62 (53%) Frame = -3 Query: 696 VLSDAIQAITLPSGSLLNNNFVGTSAQVSGYGRTGDGMFFKNFNVTFINELVFEELTINS 517 V+SDA+ AI++ + + N F GT+ + +G G+ + +F V L+ E + + Sbjct: 32 VVSDAVYAISMGTNDFIENYFAGTTRRYLQFG-VGE---YTDFLVGLARGLLVELYGLGA 87 Query: 516 RK 511 RK Sbjct: 88 RK 89 >04_01_0563 - 7216923-7217300,7217401-7217544,7217680-7218729 Length = 523 Score = 28.7 bits (61), Expect = 5.4 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = +2 Query: 440 LSSLDLVGCCVENLKTINAM*IEYFRLLIVSS-SKTSSLIKVTL 568 L + + CCVENL ++A +E RL++ S SK S ++V + Sbjct: 282 LRCVQICSCCVENLAVVDAPCLE--RLVLYDSLSKDDSCVRVKI 323 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,053,085 Number of Sequences: 37544 Number of extensions: 379791 Number of successful extensions: 1071 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1044 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1071 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2068401984 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -