BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30331 (761 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20373| Best HMM Match : RDD (HMM E-Value=6.8e-12) 49 4e-06 SB_13097| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_3284| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_26840| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 >SB_20373| Best HMM Match : RDD (HMM E-Value=6.8e-12) Length = 434 Score = 49.2 bits (112), Expect = 4e-06 Identities = 33/109 (30%), Positives = 56/109 (51%), Gaps = 1/109 (0%) Frame = +2 Query: 425 IPPLHKRLIAEFIDXXXXXXXXXXXXXXAVDTLEIIDTEKFDFQKFSEYYDDYKSAIEFT 604 + + KR++AE +D V ++ + E+F ++S D+ S E Sbjct: 252 VASIQKRVVAELLDFLFLYFTKFL-----VFSIFYNNMERFTQLQYSLIIDENTSLKELE 306 Query: 605 SGILFLEIVYRLLVCLFEAICLCGNV-GQIGGATPGKALLGLRVVTASA 748 IL + YRL+V ++E + + G + G +GGATPGK +GL VV+A + Sbjct: 307 E-ILIQALTYRLMVFMYETLFIIGGLFGGLGGATPGKYFMGLSVVSADS 354 >SB_13097| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 607 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = -3 Query: 675 PHKQIASNRQTSNLYTISRNNIPEVNSI 592 PHK I + + SNL++IS NIP+++SI Sbjct: 99 PHKSIITTTRASNLFSIS--NIPKISSI 124 >SB_3284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 545 Score = 29.5 bits (63), Expect = 3.1 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -1 Query: 233 CNKGNTLNSDIIVLVGSIFVVPENMLHVLR 144 CN G NS++I+ ++ N+ HV+R Sbjct: 182 CNDGECQNSNVILFASQAMIIRSNLQHVVR 211 >SB_26840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 274 Score = 28.3 bits (60), Expect = 7.2 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = +2 Query: 167 QALRIWIQQAQLYQNLTCFPYYMVTFQGLQNHPTNVPLLN 286 ++L+ ++ +L C ++ + QG Q+HPTN P L+ Sbjct: 201 ESLKNSVKDEELRTYEECIEHWEIESQGEQSHPTNPPELS 240 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,279,037 Number of Sequences: 59808 Number of extensions: 417143 Number of successful extensions: 795 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 717 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 788 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2082369341 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -