BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30329 (417 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1235.14 |ght5||hexose transporter Ght5 |Schizosaccharomyces ... 25 3.6 SPCC548.06c |ght8||hexose transporter Ght8 |Schizosaccharomyces ... 25 3.6 SPAC890.06 |||nucleoporin Nup157/170|Schizosaccharomyces pombe|c... 25 3.6 SPBC18H10.05 |||WD repeat protein Wdr44 family, WD repeat protei... 25 4.7 SPAC27E2.01 |||alpha-amylase homolog |Schizosaccharomyces pombe|... 25 6.2 SPAC6B12.11 |drc1|sld1|DNA replication protein Drc1|Schizosaccha... 24 8.2 SPAPB24D3.07c |||sequence orphan|Schizosaccharomyces pombe|chr 1... 24 8.2 >SPCC1235.14 |ght5||hexose transporter Ght5 |Schizosaccharomyces pombe|chr 3|||Manual Length = 546 Score = 25.4 bits (53), Expect = 3.6 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = +2 Query: 245 LSVGCRVVGGIYVVDFRGLRLPL 313 ++ GC GG++V++F G R+PL Sbjct: 310 VNFGC-TFGGLFVLEFFGRRMPL 331 >SPCC548.06c |ght8||hexose transporter Ght8 |Schizosaccharomyces pombe|chr 3|||Manual Length = 547 Score = 25.4 bits (53), Expect = 3.6 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = +2 Query: 245 LSVGCRVVGGIYVVDFRGLRLPL 313 ++ GC GG++V++F G R+PL Sbjct: 310 VNFGC-TFGGLFVLEFFGRRMPL 331 >SPAC890.06 |||nucleoporin Nup157/170|Schizosaccharomyces pombe|chr 1|||Manual Length = 1315 Score = 25.4 bits (53), Expect = 3.6 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +1 Query: 139 KLMTVSDIYFSYTNL*CATE*RKVNWPVDFCITTPSVGRVSGSWR 273 K ++S+IY S +L A N C T P VGR++ +W+ Sbjct: 415 KCSSLSNIYTS--DLFFAISSSNTNEGDVVCCTAPEVGRIANAWQ 457 >SPBC18H10.05 |||WD repeat protein Wdr44 family, WD repeat protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 586 Score = 25.0 bits (52), Expect = 4.7 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -3 Query: 202 VTLWHIIN*YMKNICRRRSLV 140 V LWHI N + N R+RS++ Sbjct: 461 VVLWHIPNKVLINASRKRSVI 481 >SPAC27E2.01 |||alpha-amylase homolog |Schizosaccharomyces pombe|chr 1|||Manual Length = 491 Score = 24.6 bits (51), Expect = 6.2 Identities = 10/19 (52%), Positives = 12/19 (63%), Gaps = 2/19 (10%) Frame = +1 Query: 223 DFCITTPSVGR--VSGSWR 273 D C T PS GR + G+WR Sbjct: 41 DHCTTAPSTGRMYLGGTWR 59 >SPAC6B12.11 |drc1|sld1|DNA replication protein Drc1|Schizosaccharomyces pombe|chr 1|||Manual Length = 337 Score = 24.2 bits (50), Expect = 8.2 Identities = 11/44 (25%), Positives = 23/44 (52%) Frame = -2 Query: 158 SETVISLLAKRNSARFPRDGSVVGTRLTSCYDRA*LMEARGRHH 27 S + L ++R + + R+G V+G +++ Y L + + R H Sbjct: 292 SSPFLDLQSERQNKKIMRNGLVIGKQVSQNYSSYKLKKRKFRRH 335 >SPAPB24D3.07c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 300 Score = 24.2 bits (50), Expect = 8.2 Identities = 11/26 (42%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = -3 Query: 295 TEIYNVNAAN--YPTPDRQMALLYKN 224 T Y NA+N PTPD + + Y N Sbjct: 18 TTAYGANASNSSVPTPDNTLVVSYTN 43 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,733,274 Number of Sequences: 5004 Number of extensions: 33545 Number of successful extensions: 69 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 69 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 69 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 146319408 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -