BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30328 (758 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 22 6.1 AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 22 6.1 AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH trans... 22 6.1 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 21.8 bits (44), Expect = 6.1 Identities = 8/27 (29%), Positives = 18/27 (66%) Frame = +1 Query: 673 RSLDAQQMQQVLDAMFEKRSEPGEYVI 753 ++ + ++QQ++D + K S+P + VI Sbjct: 113 KTSETSKLQQLVDNIEHKLSDPNQCVI 139 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 21.8 bits (44), Expect = 6.1 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -3 Query: 423 EELDRVVDHVPRLLQQITYSKLQ*DLSKVIRDL-NAS 316 E+ + HV Q Y L LSK+IRD+ NAS Sbjct: 248 EDFQMALKHVGPSSQVADYRSLWMLLSKLIRDVGNAS 284 >AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH transcription factor protein. Length = 193 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/43 (23%), Positives = 22/43 (51%) Frame = +1 Query: 421 FTRLQNNRTTTIVRGPVAGTPDESIISDEEEPPVARFNNRRKS 549 + +++ + +++ G +SI SDEE + +RRK+ Sbjct: 45 YIKVEADEEAPVLKSRSFGRKRKSISSDEENSFQGKHKSRRKA 87 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,770 Number of Sequences: 336 Number of extensions: 3736 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20338724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -