BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30326 (695 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory recept... 24 1.4 EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxyla... 22 5.5 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 21 9.6 >AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory receptor candidate 55 protein. Length = 402 Score = 23.8 bits (49), Expect = 1.4 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 568 YLIINYFGNTCSR*RLNYIIYNNSRC 645 YL+I + S R NY++ NNS C Sbjct: 377 YLVIFIQFDQSSNSRNNYVLTNNSTC 402 >EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxylase protein. Length = 475 Score = 21.8 bits (44), Expect = 5.5 Identities = 11/51 (21%), Positives = 25/51 (49%) Frame = +1 Query: 538 CCNNSFGTHRYLIINYFGNTCSR*RLNYIIYNNSRCCNNSFGTHRYLIINY 690 C +N+ H + Y G++ Y++ R + +F H++L++N+ Sbjct: 261 CNSNNIWLH--VDAAYAGSSFICPEFRYLMKGIDRADSFNFNPHKWLLVNF 309 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.0 bits (42), Expect = 9.6 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = +1 Query: 520 IYNHSRCCNN 549 IYN +CC N Sbjct: 791 IYNEKQCCKN 800 Score = 21.0 bits (42), Expect = 9.6 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = +1 Query: 625 IYNNSRCCNN 654 IYN +CC N Sbjct: 791 IYNEKQCCKN 800 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 105,628 Number of Sequences: 336 Number of extensions: 1986 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18322480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -