BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30325 (714 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0954 - 24757417-24758214 28 8.5 03_02_0764 + 10990220-10992410,10992809-10993616,10994734-109949... 28 8.5 >12_02_0954 - 24757417-24758214 Length = 265 Score = 27.9 bits (59), Expect = 8.5 Identities = 18/44 (40%), Positives = 24/44 (54%) Frame = +3 Query: 456 PRHYDDPGKGNYWMLDASADDVFIGGTTGKLRRRSALTGRARLA 587 PRH+ + YW L S +V IGG+T K R R + RA +A Sbjct: 74 PRHFCRACR-RYWTLGGSLRNVPIGGSTRK-RPRPSRPARAAVA 115 >03_02_0764 + 10990220-10992410,10992809-10993616,10994734-10994968, 10995028-10995169,10997365-10997444,10997636-10997776 Length = 1198 Score = 27.9 bits (59), Expect = 8.5 Identities = 15/61 (24%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Frame = +3 Query: 234 PKDDDNGEKKHEKPAYSYNALI-MMAIRNSPEKRLTLNGIYEYIMTNFPYYRENRQGWQN 410 P+D D+G++ H P S+ A + ++ R+ P + ++ I+ + +R++ +G N Sbjct: 579 PEDKDDGQRMH--PRSSFKAFLEVVKSRSLPWENAEMDAIHSLQLILRDSFRDSAEGTSN 636 Query: 411 S 413 S Sbjct: 637 S 637 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,347,920 Number of Sequences: 37544 Number of extensions: 245306 Number of successful extensions: 816 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 799 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 816 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1851002996 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -